SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WL68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WL68
Domain Number 1 Region: 57-95,125-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000261
Family Thioltransferase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WL68
Sequence length 218
Comment (tr|A0A024WL68|A0A024WL68_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW47281.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_04631 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKVLFIALAFSFIGFPKRGEGRYLFGRNQMKSQDIEKNNKELSNKMDTQDSKQYITYLYH
SSICQYCSKVTSMLENNDNVEIIKFKENNKIEDFGKFTKPIVVLLKNINKENSLERSIFY
EELKRKGKKVQVPALEVNNIILFESDEIIKFYKKLLQKVSNDDKSSLQNRGNIKNDQKKN
NSDYDNDYDNDDNNDDNDDDDDNNYNNNNDDGYDYHTS
Download sequence
Identical sequences A0A024VI01 A0A024W2Y0 A0A024WL68 A0A024X272 W4J0T3 W7FJ51 W7J669 W7JP84
XP_001350230.1.26446 5833.PF13_0270-1 gi|124513748|ref|XP_001350230.1| gi|23615647|emb|CAD52639.1| PF13_0270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]