SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WVB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WVB0
Domain Number 1 Region: 86-180,212-306,358-540
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.06e-78
Family Duffy binding domain 0.00057
Further Details:      
 
Domain Number 2 Region: 528-747
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.15e-38
Family Duffy binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024WVB0
Sequence length 1059
Comment (tr|A0A024WVB0|A0A024WVB0_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW51142.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_00855 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
PKPSRPEDPGRSERPTEDALPPTEDDEEDADAEEDDDEDEVEEGDHQQQQEEETPKEDTG
PQETQLPDACTIVAKIFEDDKSLKEACGLKYGTPNRYWGWRCVAPSGSNSDNNGATCIPP
RRRRLYIQKLHDWANETLSSGEKSPGDAASSTETSQTSLLRDAFIQSAAVETFFLWHRYK
EEKKPPTTQLPGTSVDSSDPDNLTPQQQLASGTIPLDFLRQMFYTLGDYRDICVGNTNIV
VNASTEDEKTAMETIQAKIQQILPKNGGTSPGTHVQQPSEKKRKNWWQKNGEHIWKGMVC
ALTYKDSGAKDKPPTQNDAVYEKFFGSTPGKPVKPGTTSGTTSGKYKTQYDYENVKLDEE
ASGDNTLLTDFISRPPYFRYLEEWGQNFCKERKKRLDQIYRECKVDKDGKNGKKCSGYGE
DCDEIRKQDYSTVPDFFCPDCGKSCSSYRKWIERKKDEYEKQKNAYEEQKSNYENEHNCA
KRTDDDNGFCKTLKTCTDAASFLKRLGPCSKNVSGKDNEKIFEDKDKTFRPADNCKPCSL
IGAKCKNGNCGGSPNGNTCNGKNSIDANDIKGMAKFTDQVDMHVSDNSTTEFNGLEACKD
AHIFKGIKEDKWKCGTVCGVDICKLQKNNNGEANENQIIQIRALLRLWVEYFLDDYNKIK
HKISHCKKNGEKNICINDCVEKWINIKKKEWETIRKRYFEQYKGAESDVYDVKGFLEDLQ
SQIPVTINKAIKPCSDLNAFERSIHCNGAVSSENDIQKDVVECLLDKLKKDAENCQNQPS
GTPCTQTTSQQTLEEEDLLLEEDEQNTLVKEKVGNKAPTFCEIEEKKEKEEGGCDAPEEK
TKENDQAGAEELKPAAETKDTENQPPVPKPAPTKPQRPRRPRRTLELLDNPPFKTALMSS
TIMWSIGIDRHRNMCEQWNKNKKEELLDKLKEEWNKKNNNNSDLTHTSSNIPSGENSIKN
VLNTDVSIQIDMDDPKPINEFTNMDNIIDNLEKNSEPYYDIDEDDIIYFDIDDEKTPMYH
NNMDNNKSNVPTKVQIEMNVINKQELFQEEFPISDIWNI
Download sequence
Identical sequences A0A024WVB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]