SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WWH9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WWH9
Domain Number 1 Region: 1-150
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.44e-18
Family Duffy binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024WWH9
Sequence length 189
Comment (tr|A0A024WWH9|A0A024WWH9_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW51298.1} KW=Complete proteome; Reference proteome OX=1036727 OS=Plasmodium falciparum MaliPS096_E11. GN=PFMALIP_00663 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLCQYNGDDKKEHCNEYEEIDKTPQFLRWLEEWARKYCTEKSTRAREINETCEDDIINKI
HTYSIDNIPDEPCKTALTKYRNWYNNNYLHWENLKKKYESNKKNEKEQTTNGAHLSPSTT
TSFYKDDDAEAYVKRKCKECTCNYKDLQEEYKRITEGNNEVSTLIHRARIDSFDLKKRLF
YNILTLGGL
Download sequence
Identical sequences A0A024WWH9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]