SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WYJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WYJ0
Domain Number 1 Region: 84-200,232-324,384-561
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.57e-72
Family Duffy binding domain 0.00064
Further Details:      
 
Domain Number 2 Region: 549-774
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.67e-38
Family Duffy binding domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024WYJ0
Sequence length 956
Comment (tr|A0A024WYJ0|A0A024WYJ0_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW58074.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_06029 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
THTNPCPPKPASPAGGGGPGRSLDTKPDPTDAGDDDDDEDEDEDEDEDEEEEDHPDDNVE
EEEETAKEDGPGATEEVEEPAAPPLPTVNVCETVAKALKIENLKEACSLKYGPGGKEKFP
NWKCISSGSDTTSDKDGSICLPPRRRRLYVGGLSQWANKHNTEAESQETGETSSPSGDKL
REAFIQSAAIETFFLWDRYKKEKEKEEKEEQAQLVTNTSSVHEKPQNKLEKGEIPDGFLR
QMFYTLGDYRDICVGVKEDVIEALKASGDNNIETINNKIKTILNGDTSPPTPPGTPSAQT
PDKWWKNHGEHIWNGMICALTYKENGSGGDGKTTTITQDTNLKEQLLENGKNTPKNPRYQ
YNSVKLDDTSGAKSTQPPTSGDNTPKLSDFVLRPTYFRYLEEWGQNFCKERKKRLQEVEK
GCVKNGNKKCSGYGEHCDDQLRNEPTTLHSLECPDCGKYCSSYKKWIRRKKDEFTQQSNA
YTGQKDNYVNEHNDAKSKSGDIYDEYFVGKLSTVYTSIKLFLEKLGACSKTDNGNQRAED
KKIFEDEAKTFGPSDNCKPCPKFKINCNGNGHCNNGKEKDCKTKTVITVDDIKKMRNSTD
DVSMLVSDNSTTEFKGGLEPCQNAGIFKGIKENKWKCRNVCGYVVCKPENGNTETGSGEN
NDQIITIRGLVEHWVHNFLEDYNRIRKKLKACMKNGKGSTCTSDCVKKWVEKKRVEWEKI
KKRFNEQYKNDNQPDYSVKTILQELIPQIGAANANNDGKKLIKLSVFDQSCGCSASASST
NGNEDAIDCMLKKLEKKISECKTQASEETQNQTCQDPPPELDEEDLTLEETEENTEEAKK
KMPKICEGVIQTQTPEENEGKCETAQTTSEESAEPPSSPTGTSGEETNSEQTPVLKPEEE
APAQQPPAQPLPQPPSRPQRTPELLEKPHVLTALVSSTLAWSVGIGFATFTYFFLK
Download sequence
Identical sequences A0A024WYJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]