SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WYV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WYV3
Domain Number 1 Region: 55-266,301-350,373-453,488-507
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-82
Family Duffy binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 500-726
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.81e-33
Family Duffy binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024WYV3
Sequence length 727
Comment (tr|A0A024WYV3|A0A024WYV3_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW58013.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_06089 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVTQGGGNPKDASAKHMFDRIGKDVYKEVKKEAERRSNGELKGKLQEAKGSGGELAAFRD
TCNLVDDYYKHTNGGVKGKRYPCGNGSASDKRFSVKQQAEYDNKKMKCSNGGACAPYRRL
HLCDKNLETISNYDSNARHKLLAEVCMAAKYEGASIKTHHPQHKVTYPGYHSQICTELAR
SFADIGDIVRGRDLYRRDNKKDKTDKLQEQLKKYFQKIYDNLKDSTLKDKYKDEKDRNYY
KLREHWWNANRHTVWKAITCNEELRGDAYFHARCSDGQGGAQANHYCRCNDDNPGVDKPN
IDPPTYFDYVPQYLRWFEEWAEDFCRKKNKKVENLEKSCRGEYGGEKRYCSGNGCDCTKT
VRARGKLGYGNRCIDCLYACNPYVHWIDKKKEEFDKQVKKYKTEISVGGGRAKRAAITTK
YEGYEKKFYKELKESGYGNVDAFLGLLNKEEVCTAVNDDKGGRISFENVNSRGGDGGAAS
GDSGTGASADSNSNKTFYHSEYCQPCPYCGMKKEENGEWEAKVNDDNCKRGNIYKPIDGK
KGTEIKILKSGENQKEIENKLNEFCAQANGDTTNNGGNGTGVGGGGSGGNSEKKELIEKW
QCYKGEDVMKPEDHDDQQDYENMKSAGGLCILENPKKNKEEGGNTSEKEPDEIQKTYNDF
FYYWVAHMLKDSIHWRTKKIKGCLENGTKTRCNKKNKCNSDCDCFQKWVKQKETEWNAIK
EQFRKQE
Download sequence
Identical sequences A0A024WYV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]