SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024WYY1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024WYY1
Domain Number 1 Region: 466-803,842-860
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-78
Family Duffy binding domain 0.00016
Further Details:      
 
Domain Number 2 Region: 882-1121
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.31e-56
Family Duffy binding domain 0.00069
Further Details:      
 
Domain Number 3 Region: 113-322
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.09e-30
Family Duffy binding domain 0.0048
Further Details:      
 
Domain Number 4 Region: 2-33,65-122
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.000000000235
Family Duffy binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024WYY1
Sequence length 1121
Comment (tr|A0A024WYY1|A0A024WYY1_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW58078.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_06025 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MYETWIDNQKKEFLKQKRKYTSEMQKYTNGAVGNGTGRTKGGASSTNYDGYEKIFYEEFK
RNGNYGTVDKFLEKLNDEDVCKKITDEKEKIDFKTADNSLNKNINKEGTFYHSEYCEVCP
GCGVDCDGTKCTARPEGHEKCKEEINKIHKKEAKTTNIEFLFNDKPGDDIVKKLNAFYYP
TGPHNKDKGIEDWKCSHYSVDDDECVMQKNGTSAESHPKRMQFVDFFLFWVTHLFNDVIE
WRNEISKCITESSLKKCSNRCNRYCRFFKKWVEQKKTEWGQIKRHFDTQEGLADAGHDVI
LEVFLEQEFLPVIEQAYGDKKSIQKIVNFLKQDISKRRDHNVANKEEIVQKLLDHELEDY
EKCKETHNDDRCSQDTQGGRSGGTHDHEDDSDDEEPPTPLVDNACSGDPGGNTTHRSIVN
RVAHHFREVAHNKMKENIKSNSVKGSKHNVLEADATKGIYKSSGNSVPLTDICSITEDHS
NRNPKNSSGPCYGKDGYGQRFVIGTNWEGGTSVSTTPEIYLPPRRQHMCTSNLENLNVSW
VTENGKASHSLLGDVLLSAKMDAIKIIQKYNNHNVKENLKDLIDEATACRAMKYSFADIG
DIIRGRDLWDEEGGMKSVRGHLEKIFGTLHRSLDGIQGNKKYNDDDKKSPPYKQLREDWW
EANRSQVWDAMKCSLPNSSIKCGRYPPFEDYIPQRLRWMTEWAEWYCKMQKEAYEKLMKQ
CKECKDKGDDCRNNSAECSPCKQACEEYKTKIETWRKQWKQMEIQYTPLYLQAKKPHAGN
AYPGADYQQMVHFFKELQEANGDTKFGDTTSPYFTAERYIHQELPNVGCNTQTEFCDQKN
GNNNINYTFKHPPKGYKEACDCKSRPKSAPEKKDAEPKVVEGGGDKECEKVNKILQFKKG
KTSIEECHEKNYGQTDPDWKCGNETLVTDKNTCMPPRRQKLCLYYLTQLGDNEKEDKLRE
AFIKTAAAETFLSWHYYKSKNDNSVETQLKEGTIPPEFLRSMYFTYGDYRDICLNTDISK
KEGHVGTAKTKIDKIFPKPIEISLSGKTRQQWWEKNGQHIWKGMLCGLTHGVTETDKKKN
ILDKYSYDKLKNEPQNGNASLEDFAKKPQFLRWMIEWGEEF
Download sequence
Identical sequences A0A024WYY1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]