SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X0F8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024X0F8
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.35e-31
Family Thioltransferase 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024X0F8
Sequence length 104
Comment (tr|A0A024X0F8|A0A024X0F8_PLAFC) Thioredoxin {ECO:0000256|PIRNR:PIRNR000077} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_05648 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MVKIVTSQAEFDSIISQNELVIVDFFAEWCGPCKRIAPFYEECSKTYTKMVFIKVDVDEV
SEVTEKENITSMPTFKVYKNGSSVDTLLGANDSALKQLIEKYAA
Download sequence
Identical sequences A0A024UZ52 A0A024VL83 A0A024VYA8 A0A024WJ11 A0A024X0F8 A0A060S5G9 A0A0L1I397 A0A0L7K754 A0A0L7M3U4 A0A144A4E0 A0A2I0C2V5 Q7KQL8 Q9NFK9 W4I981 W4IXY3 W7F6V3 W7FXT4
5833.PF14_0545-1 XP_001348719.1.26446 XP_012765615.1.2076 PFHG_00690T0 PF14_0545 PFDG_03720T0 gi|124809933|ref|XP_001348719.1| gi|23497618|gb|AAN37158.1| gi|75009811|sp|Q7KQL8.1|THIO_PLAF7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]