SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X272 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024X272
Domain Number 1 Region: 57-95,125-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000261
Family Thioltransferase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024X272
Sequence length 218
Comment (tr|A0A024X272|A0A024X272_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW59273.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_04751 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKVLFIALAFSFIGFPKRGEGRYLFGRNQMKSQDIEKNNKELSNKMDTQDSKQYITYLYH
SSICQYCSKVTSMLENNDNVEIIKFKENNKIEDFGKFTKPIVVLLKNINKENSLERSIFY
EELKRKGKKVQVPALEVNNIILFESDEIIKFYKKLLQKVSNDDKSSLQNRGNIKNDQKKN
NSDYDNDYDNDDNNDDNDDDDDNNYNNNNDDGYDYHTS
Download sequence
Identical sequences A0A024VI01 A0A024W2Y0 A0A024WL68 A0A024X272 W4J0T3 W7FJ51 W7J669 W7JP84
PF13_0270 5833.PF13_0270-1 XP_001350230.1.26446 gi|124513748|ref|XP_001350230.1| gi|23615647|emb|CAD52639.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]