SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X3B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024X3B0
Domain Number 1 Region: 15-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.57e-33
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024X3B0
Sequence length 208
Comment (tr|A0A024X3B0|A0A024X3B0_PLAFC) Protein disulfide-isomerase domain {ECO:0000313|EMBL:ETW59281.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_04758 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAIFKKSIIIFLFFTFFNYCFSQDVIELNDSNFESLTQLSTGNTTGSWFIKFYAPWCSHC
KAMSKTWAQLATELKGKINVAKIDVTLNSKTRKRFKIEGFPTLLYFKNGKMYDYKNHDRS
LEAFKNFVLETYKNAKASEPPKPLNYMDILKDFLNETFQNIDRIYKYAFPSLAVLVSVSF
LTGSIFSLILLKCCCMKSGASKVAKKKD
Download sequence
Identical sequences A0A024WL80 A0A024X3B0 A0A060RY51 A0A0L1IG45 A0A0L7KD91 Q8IDH5 W4ICC7 W7F8Q7 W7FP48 W7JNJ8
PF13_0272 gi|124513762|ref|XP_001350237.1| gi|23615654|emb|CAD52646.1| 5833.PF13_0272-1 PFHG_03051T0 XP_001350237.1.26446 XP_012764892.1.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]