SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X3V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024X3V1
Domain Number 1 Region: 66-268,303-409,443-504
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.76e-83
Family Duffy binding domain 0.0001
Further Details:      
 
Domain Number 2 Region: 497-699
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.41e-28
Family Duffy binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024X3V1
Sequence length 699
Comment (tr|A0A024X3V1|A0A024X3V1_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW60222.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_03994 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPGGGGHGGGEEDKDAKHMFDRIGQQVHDKVKKEVYGTGASGDAKKYIEELKAGVSFAT
LSGGELAAFPEPCKLIKDKGHKILAARGHPCRKEDVDRFSDKEGAQCNKSRIRDSEKNSE
GACAPYRRLHVCDRNLEQIKTENITTHNLLVDVCMAANYEAQSLIRYHDLYKLTYDDSQI
CTVLARSFADIGDIVRGKDLYRRDKGEETKLEKNLQNIFKEIYEELKDPRAKERYKDTKN
FYQLREDWWTANRHTVWKAITCSDDLKDNRYFRQTCSDTHGSFVAIHYCRCNNDQPNADN
PNTDPPTYFDYVPQYLRWFEEWAEDFCRKKKKYVDIVKTYCRDETKGKYCSLNGYDCTKT
KLAIGKYRMGNQCTKCFFACYPYEKWIEKQKEQFDKQKKKYTDEMKKYKNGGGGSGSRRQ
RRAARNENYEGYEKKFYDELKGNYSDVNAFLEKLNKEKACTAVDDDKGGKIDFKNVHGGT
SDTSGTNVESQGTFYRSKYCQPCPHCGMKRKSDGSGWEERKENDNCKNINLYKPINGKNG
TTINFLYSGDETNEIGKKLKAFCDQINRGTTNAASGGGSKSDSQKLYQDWKCYQFEDLQK
DGQDGVEDEDDGEYDGLVRNSGGLCILENKKHVSGNNSSNEPAEIQKTFHDFFYYWVAHM
LKDSIYWRTKKLGRCLENNNGNTCKKNNCNDKCKCYESW
Download sequence
Identical sequences A0A024X3V1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]