SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X6V5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024X6V5
Domain Number 1 Region: 74-384
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.03e-72
Family Duffy binding domain 0.0000612
Further Details:      
 
Domain Number 2 Region: 556-821
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.02e-48
Family Duffy binding domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A024X6V5
Sequence length 821
Comment (tr|A0A024X6V5|A0A024X6V5_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW60531.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_03570 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MDSTSTIANKIEAYLGAKSDDSKIDELLKADPSEVQYYRSGGDGYYLKNNICKITVNHSD
SGTNDPCDSIPPPYGDNDQWKCAIILSKVSEKPENVFVPPRRQHMCIKNLEKLNVDKIRD
KHAFLADVLLTARKEGERIVQNHPDTNSSNVCNALERSFADIADIIRGTDLWKGTNSNLE
KNLKQMFKNILEKGSTIQSNYSKDQNYRKLREDWWNANRQKVWEVITCGARSNDLLIKRG
WTTSGKSNGDNKLELCRKCGHYEKEVPTKLDYVPQFLRWLTEWIEDLYREKQNLIDDMER
HREECTRKNVDSKEGTSYCSTCKDKCKKYCECVKKWKTEWENQENKYKDLYKKDKRKKSS
AKHASRYDDYVKDFFEKLNEANYKSLDDYIKGDPYFAEYATKLSFILNSSDANTSSGETA
NHNDEACNCNESEISSVEHASISDPSSNKTCNTHSSIKANKKKVCKHVKLGVRENDKDLR
VCVIEHTSLSGVENCCFKDFLRILQENCSDNKSGSSSNGSCDKNNEEACEKNLEKVFASL
TNCYKCEKCKSEQSKKNNKKWTWRKSSGNKEGLQEEYANTIGLPPRTQSLCLVVCLDEKE
GKKTQELKNIRTNSELLKEWIIAAFHEGKNLKPSHEKKNDDNGKKNDDNNSKLCKDLKYS
FADYGDLIKGTSIWDNEYTKDLELNLQKIFGKLFRKYIKKNIASDENTLYSSLDELRESW
WNTNKKYIWLAMKHGAEMNGTTCNADGSVTGSGSSCDDIPTIDLIPQYLRFLQEWVEHFC
KQRQAKVKDVIENCKSCKESGNKCKTECKNKCEAYKKFIEN
Download sequence
Identical sequences A0A024X6V5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]