SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X6X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024X6X6
Domain Number 1 Region: 1527-1824
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-55
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 1190-1474
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-54
Family Duffy binding domain 0.0000279
Further Details:      
 
Domain Number 3 Region: 414-744
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-51
Family Duffy binding domain 0.00012
Further Details:      
 
Domain Number 4 Region: 738-927,964-1082
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.58e-47
Family Duffy binding domain 0.00028
Further Details:      
 
Domain Number 5 Region: 179-324,352-359
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.0000000000654
Family Duffy binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024X6X6
Sequence length 2247
Comment (tr|A0A024X6X6|A0A024X6X6_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW60556.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_03569 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MRYSKYIEDAKRNRKAGTKNCGPSSITNVSASTDENKCVQSDIDSFFKHLIDIGLTTPSS
YLSIVLDDNICGDDKAPWTTYTTYTTYTTYTTYTTTKNCDKERDKSKSQSCNTAVVVNVP
SPLGNTPHEYKYACECRTPSNKELCDDRKEYMNQWSSGSAQTVRDRSGKDYYELYTYNGV
KETKLPKKLNSSKLDDKDVMFFNLFEQWNKEIQYQIEQYMTNANISCNNEMNVLSSSSEE
SQNQKGSDHHDGGNNNTDQGTNCKEKCKCYELWIEKINDQWDKQKDNYNKFQRKQIYDGN
NASHKKEIVKLSHFLFFSCWEEYIQKYFNGDWSKIKNIGSDTFEFLIKKCGNNSGDGETI
FNKKLKNAQQQCKEIQNTDTKINPSVISSVLNATNYIRGCQPKRYDGFISPGKGGEKQWI
CKDTITHGDTNGACIPPRTQNLCVGELWYKSYGGRSNIKNDTKESLKNKLKNAIQKETEL
LYEYHDKGTAIISQNDKKEKANNNNSNGLPKGFCHAVQRSFIDYKNMILGTSVNIYEYIG
KLQEDIKKIIEKGTPQQNGKTVGSEDKVNDWWKGIEGEMWGAVKSGIKTINKKQKKNGTY
TGNECGVSPPTGNDEDQFVSWFKEWGEQFCIERLQYEQNIREACTINGKNEKKCINSKSG
QGDKVEGACKRKCEEYKKYISEKKKEWDKQKTKYENKYVGKSASDLLKENYPECISANFD
FIFNDNIEYKTYYPYGDYSSICSCEQVKYYKYIKDKGQNNKSLCHEKGNDRTWSKKYIKK
LENGRTLEGVYVPPRRQQLCLYELFPIIIKKEKDMEKAKKELLETLQIVAEREAYYLWKQ
YNPTGKGIDDANKKACCAIRGSFYDLEDIIKGNDLVHDEYTKYIDSKLNKIFGSSNKNDI
DTKRARTDWWENETINVANITDTNKSDSKTIRQLVWDAMQSGVRKAIDEEKEKKKPNENF
PPCMGVEHIGIAKPQFIRWLEEWTNEFCEKYTKYFGAINSKCNLRKGADDCGDNSNIECK
KACANYTNWLNPKRIEWNGMSNYYNKIYRKSNKESEDGKDYSMIMEPTVIDYLNKRCNGE
INGNYICCSCKNIGENSTSPVANKKAQRKDEQCEDNKGPLDLMNEVLNKMDEKYSEHKMK
CTEVYLEHVEEQLKEIDNAIKDYKLYPLDRCFDDKSKMKVCDLIGDAIGCKDKTKLDELD
EWNDMDMRDPYNKYKGVLIPPRRRQLCFSRIVRGPAHLRSLNEFKEEILKGAQSEGKFLG
NYYKEKKDKEKKEHKDKEKALEAMKNSFYDYEDIIKGTDMLANIQFKDIKRKLDKLLTKE
TNNNTKKFDDWWETNKKSIWNAMLCGYKKSGNKIIDPSWCTIPTTETPPQFLRWIKEWGT
NVCIQKQEHKEYVKSKCSNVTNNNLGSQESESKNCIPEIRKYQEWSRKRSIQWEAISERY
KKYKGKDEFKNVFNNANEPNANTYLKEHCSKCPCGFNDMEEIANNKDNEKETFNRIIEKV
KIPAELEDVIYRLKHHKYNSNDYICNKYKNINVNMKKNNDNIWTDLLVKNSSDINKGVLL
PPRRKNLFLNIEKSDICKYKKNPKLFNDFIYSSAISEVERLKKVYGEARAKVVHAMKYSF
ADIGNIIKGDDMMENNSSDKIGKILGDGDRKNEKRKASWDSNKYHIWESMLCAYKKAYRN
ISDVDKKMLDIPNNDNEHQFLRWFTEWAEDFCNNRYKELEKLKMSCPHNVCFLDEGTEKK
CIEACEKYKNYVLTKKTEYEIQKNKYDTEFKNKNSNDKDAPDYLKEKCNNNCDCISYHID
DKKNWKEPYETLDNMKLKGICDCPKPLPLFSDNTSDILQKTIPVGIALALGSIAFLFMKK
KPKTPVDLLRVLDIHKGDYGIPTTKSSNRYIPYVSDTYKGKTYIYMEGDTSGDDDKYIWD
LSSSDITSSESEYEEVDINDIYVPSLPKYKTFIELVLEPSKRDTFNTSSGDTFTNKLTDD
EWNQLKQDFIEQYLQNIQKDFILHDSMDEKPFITQIQDRFLDSSHEEVTYNIDWNVPENI
NRITNNMDDPKYSSNNMYTGTDLINDSLNGNQYMDIYDEMLKRKENELFGTYHTKYTTFN
SVSKQTPSDPIINQLDLYHNWMDKHRDICEQWKTKEDMLYKLNEVWNMERKEYLLDIQPS
TLDDIHKINDETYNIISTNNLYSYENNDITPHQLGLPNIIPSGIIKHQDNGLRTNISMDT
YIDETNNNNVVATSIIGDDQMENSYNC
Download sequence
Identical sequences A0A024X6X6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]