SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024X734 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A024X734
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.6e-41
Family Thioltransferase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A024X734
Sequence length 193
Comment (tr|A0A024X734|A0A024X734_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW61299.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_02719 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNNSVTRKIEKQILEALKDKENDIDKEIRKYEILERKVYDENDEELEFIKNKRLEELKNK
HKEKLTLLKKGHGTYKEVLSEKEFFEICKSSKNVCCHFYRNTTWRCQYMDKKLIDLSSKY
WNINFIKINAEKSPFLCERLKIWCIPTVMLIQNGKTEHSIVGFDELGGDNFSEQTLVNVL
RKWRLIETKENDD
Download sequence
Identical sequences A0A024V700 A0A024VGV4 A0A024W7L5 A0A024WQH3 A0A024X734 A0A0L1IF78 A0A0L7K9P6 A0A0L7M7H4 Q8IJX5 W4IG44 W4IWH9 W7F7K2 W7FUW0 W7JC94 W7KFF9
5833.PF10_0066-1 PFHG_01574T0 PFDG_03558T0 PF10_0066 gi|124802067|ref|XP_001347351.1| gi|23494930|gb|AAN35264.1| XP_001347351.1.26446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]