SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A024XE24 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A024XE24
Domain Number - Region: 42-80
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0131
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0095
Further Details:      
 
Domain Number - Region: 107-150
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0314
Family NusA extra C-terminal domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A024XE24
Sequence length 246
Comment (tr|A0A024XE24|A0A024XE24_PLAFC) Uncharacterized protein {ECO:0000313|EMBL:ETW63036.1} KW=Complete proteome OX=5835 OS=Plasmodium falciparum (isolate Camp / Malaysia). GN=PFMC_01017 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSKNYSESQSLTENNSDKKSKIDDDLSSNEDSNLSSNKLNKKSIYSKKSNVQQLLARIAQ
EIDERKPNNVIHFMVDFLCKHYPEHLHGFEAIWNGDPDLEQERLLVVEFFKYQKLPVEIS
VHFINAGFDTVDTLCTLSNNSLDDVEKFNNTRWLPGHKVRLQQTFNDITNRVRIFKEERN
ALIKCLKREFVNHSPNMINSVIVPKTIKPIMVPVLPTVGTPVNVSARPNNYLSVGKTLPP
HIYRRS
Download sequence
Identical sequences A0A024VHU0 A0A024WBP5 A0A024XE24 A0A0L1IFC3 A0A0L7KIN0 A0A0L7M7G0 Q8I401 W7FHW7 W7FUB1 W7KAW3
PFE0510c gi|124506127|ref|XP_001351661.1| gi|23504589|emb|CAD51468.1| XP_001351661.1.26446 PFHG_04977T0 PFDG_02736T0 5833.PFE0510c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]