SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A026WQ96 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A026WQ96
Domain Number 1 Region: 24-63
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000889
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A026WQ96
Sequence length 2184
Comment (tr|A0A026WQ96|A0A026WQ96_OOCBI) Sperm surface protein Sp17 {ECO:0000313|EMBL:EZA57871.1} KW=Complete proteome; Reference proteome OX=2015173 OS=Ooceraea biroi (Clonal raider ant) (Cerapachys biroi). GN=X777_00973 OC=Vespoidea; Formicidae; Dorylinae; Ooceraea.
Sequence
MLSPTPAIDRSSLHPGTGYLIAPRVPRGLAAVVEGLTREVLRHRPEDIYVFAAHHFEKLL
KLREQYHAEEYSDRELSHEFNREFNLWSTKNAETRDVRKSSNGGWSLEKEIEILEGHRKV
SADVEESPEDVSTDKEPRKVSKQASSKVPTATKRVSRRSKAKEMTSDARATKIISQMPGL
HGPSKNIQAKDIKQELRKNKLSGEKGKTVDGADKAIRGERRSRTRISKSDKGPEEEVECP
TTTAVTTTTSKTSSRRPLKKVRRIETESETETERETKARFEKGYERSNIKSENISRNAIA
RTGSRERRPEAQLSEHSSGRKVSSRALSMDRIRAYVLRKFASTASLEVLRSPTYVEQVQE
VIDRAAPIIKEKLEEIRRPRGKRSRSVDLGWNDESFRQRMREDKKRDNGDEEEESRERRN
GSEREIDSAEQEETENSLGRNGTILKKEEKKQRRRSVGSGKRSKKREGDGSADLDVADDS
SKHDGKSEHESDESRDTLEARLTATQNILEGIAKSTSELGGICRIESGEPLESEATDHAN
VVSLPIVRPPSSKNSKSTIKNGADSLTLPPISPEAPKSAKKKDELSLPVLPANGNHSAVK
SQEQDASKDVEEASTMRDITSDIEDIAILPEDDHVIPDIDQGPESEDLIPDIRTFVNEEK
DERDENINELLREDTSEKHAERRESVEEFKELEELVRERGRVEEVFKDSLNVTPEIVDVP
PRPDSLEPEDEVKLEDDGLDPARDNRFDGLKDKLMEIEMAEKSIEKVLAGQQIATCDGGE
TTSQAEKSITDAEINEAGMLADEVEETVREIKKSIDKAEISMNKEEKKDNDKENTESTSE
AEKIENVVEVSNETESVSTKAEKSINLVKEMKNKTESLTKETENSKKSMNGTEKSTSETK
RTKNGMEILETEIDTVVNQTDTSTKIMEEAIEAVETKKSTDENERSINGKSPNNDIEELV
VKVHVGDAQSVNVKLQDKDDQITEAVISETQNDSDATESKSKAEVTNESSEIIVPENVVA
KAETSRKNSLDEGSVGETRKKREADKSPTTSPLSAEIPFAYILSEGSPCEIPDSVTTVII
PDRPYLSPVTLEDESHPLGPINKKEDLIIRSDVAKEDEKQGKGRNEYEMEAFGEYIPPET
TSLPVDIDFVRGAKGAKLGQDVVVVHQDLDKIKEEGEEEEEEKKERIEKGEINISEEKDD
DKQKVVQGEETIKLSGMLENIVEHEENEESDAETNTELKGAKQIVSVDVHTYESLPDTTE
VIDTGMTDNGRADVVMEPRSTLETSSEESGSTQDNHTTTSSDVKESTASNQSGEIESSSL
GRPVVPELNLDSLQDNTVSSFKMTANGTTKEDNGSPRESDTMTSLIEPLTSDERLMNRPS
LVDNEEEVPVEQLTEDLSIDLRSAPEADQLYQAEHAEYEWLEKDPLSSETILDDEAKSQE
DSIGLLTLPDDIVQIGPLLQEKEEEEKLSSEEEIARELIGSLNEEMELRAKELDSKEESK
DSGESVRSNLAVDDKASQVLSVPSTSVDELKQKERKSSSEEFKELNNEIEKSKTEVVDKV
SHITDISQIDKNKEDTETEKSKLVEEREETTQVAPLAQFEQDELLEPSSRPGTANKKITV
ESKPNTIDTDFSDNQEKHENKKTSVEEVLQKGKESIDEAEDSSKKQEENEQGKIPEECKQ
EKLKMQEENGGNLQLQEEMVDTKTMASEITESKKDSINETKNDKKHDENDQTNQDKSISE
KEVKNEKETVEEKTKDLSAEGESFEESIPSAISEQSMKDHPHGYWTAETKSSTVETVIET
VSPNTSTDKEVKAVAESEIIEDESHSTKKDDFYWAVVKIQACIRGFLARRRMQKDICPKP
VSDSVPSAQKTATASTIPQDTPNLRETRRLRREEALRNTTLSLENAFAIGRLQHTSEFHD
SVPLPLFDVTNGEVNSILLKESTSKEEDVEQDKQSDAAKPDTNETDSVHDNEHARNFQKS
FTNHSAFPIVMHLMTDTSRNGHFRINQSYDPDFNPSVGETKPVQQAMDILMLGYPRDDDN
RYLNFITSVEDLGNMDSLPLDDAVKTSKSTEDAYPSMISSEGSIREPLALPGTPQSIVIE
EVTSLDGTVPFVEDEKDDLGMLPSTLDIIGDRKHIDEGVDRQKLRKTPTTVGDDNLESSK
KLICMPRRVRDVEDLLCLSIVRNT
Download sequence
Identical sequences A0A026WQ96

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]