SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A031HJX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A031HJX6
Domain Number 1 Region: 5-135,192-252
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.00000000000000226
Family Haloperoxidase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A031HJX6
Sequence length 254
Comment (tr|A0A031HJX6|A0A031HJX6_9SPHN) Alpha/beta hydrolase fold protein {ECO:0000313|EMBL:EZP49037.1} KW=Complete proteome OX=1470591 OS=Sphingomonas sp. RIT328. GN=BW41_03705 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MRSLITFPCAGETLIGSLDMAAGATGLLIVSGGNEIRCGAHRGMALLAAAMTARGHPVFR
YDRRGIGDSSGDNHGYLSARGDLVAAAEAFRAAAPQLATIVAYGNCDAASLLALHGREAG
VDRLILANPWTIEDFDDLPPVAAIRATYRQRLTSRRAWARLLSGRIDLGKALRGLHKAST
ALPQTLARRIVGAIENWGDAATIILASGDATAQAFAAAAPHLPAHRIDTASHSFARETDQ
RQFQALVAGLLEDQ
Download sequence
Identical sequences A0A031HJX6
WP_037536332.1.17274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]