SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A044RME0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A044RME0
Domain Number 1 Region: 64-106
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000536
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A044RME0
Sequence length 109
Comment (tr|A0A044RME0|A0A044RME0_ONCVO) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:OVOC12304} KW=Complete proteome; Reference proteome OX=6282 OS=Onchocerca volvulus. GN= OC=Spiruromorpha; Filarioidea; Onchocercidae; Onchocerca.
Sequence
MSTRIEEAKHQLRDINDLRHLLNDLRMKIIEARINFIYYRWKYLVIDELLLRLSRPDMKI
GKEEVPTLLHLCRLAIRKSFPASQLANGRFVENLPIPSSLKDYLRLLSL
Download sequence
Identical sequences A0A044RME0
OVOC12304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]