SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A058ZEP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A058ZEP4
Domain Number 1 Region: 345-469
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000206
Family Regulator of G-protein signaling, RGS 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A058ZEP4
Sequence length 1742
Comment (tr|A0A058ZEP4|A0A058ZEP4_9EUKA) Uncharacterized protein {ECO:0000313|EMBL:KCV72880.1} KW=Complete proteome; Reference proteome OX=691883 OS=Fonticula alba. GN=H696_00451 OC=Eukaryota; Nucleariidae and Fonticula group; Fonticula.
Sequence
MFTGAQGPLPPGQVTGSTDLPPGFSLESIPPLTIKAFLHESFVTVSVRPDSTIERLSDII
AEAFIKHFPNIPSFSCSALLDEALVPLQFADLAGHVLSNGSILRVVPIPLTSLDATSPGA
LGVARVSTAAMMAPCKDAPPTTAVVSSSSSSASSMTTTMAASASASTSAAATGLSIDKDV
PPSGEESPTSETDDTTTSTASSTVTTSSMTTESSDQPPANFNPAARRGSQLLFQLGSNAA
MSTNLKDYDLVENGPLPPAAAAAPATVLSAGSSLGSLLEEDSPSILAIELETHVEQGPPS
TGAAPVAPSVVPAAGAAAATPSSAATPASPNHAVLANLFFDDQELYNALRNRAFLRSFAE
FCEFQYCLEPVLFWMDTEAFQFLARAQDARDLQVGRLVKMAAWIQAHYIDPEGPLRLNIH
SNALATISAPFTTSSPPRADGFHNAQARMFSVIRDVLLPQYIRSRFYRDLERRIRRDPTS
YQQAYVENIGEHFASLLRAEDSWSVSWKKIPAPKPAPDARASAANSLPPVAPVYNESPEQ
ILSIVLRRYWPEAPFPRLYFLERQRVLVQKRQQQIQLIRRLRKFFGDQPMLDSIVNISPM
RYSAGPNAGGMLDAAGRSSSALLSPSSSGRVAATHFASSSALPLLGSGSSLSLDDGSQVT
ASSSSASIAMAGTGVGAAPAATAAAAASGTASGSGGEATSGAAGPNLNSTLRLAEGGKSV
TNGSARSVSLSMGVRPTPSGGGSGSGAPGSGLNLGWGITSSLSVDSFDDLLNGIANTPIM
GQRAGPGALRPASGFGPYDLQMSYSHSSHELNAHPSLAGGAGGAGGGAGSASGDRFIKMR
RAEKLQDFFGDKLPSHALADQKIHRPENFAAVDLSREDQDSTDPLGTSHHQQSKAGASST
RYLGQFGLFAEEGGAAGGSGSGGGSGGRGQNVLGPRDILAPAPTSNILTSEERRILMKRS
RKLNRVLGNPIGEEFLLETATAAALAAQQQPASTVTAAGAGSTDGHHPSHHRGPSPLGSL
GRAASTESCPGSPPPLAMNVRRNTDPLGRTLTHESIAISASGMIPAGVDGSNPATYFGST
TSLSMHHSASAGTLRGGNSPGPDILGHAQVGLCDSPAGGSSSMGGTPVAMGLPPVTGTGQ
HTGSPTSLASGLAAPAGGQLLSSSSSQQLGYLAPPGTMTRAPSSIIVGSGVTTIGGLATL
PSPEPLASDFLSSRRSTFFSTTQGLGSGIGGTAGGSASAGGAGIDDIDAGALLMATVSSD
EEDDDPYQRKEYRLRKLSKLQEFLGERLNRQLLESQQIIPRPHMSPEERRAQQKRLRKLA
SVFGHHPPAPGEGPTDDFPADQMAFLQDSSSSGDLSSSLLIHPSDPLEVRNSKSIRALAF
LVDNQDDSELDDFFKRIADLELEDSSSAAAAVATADVSSPVDPARARQARQKKLKKLQRF
FGETFSEEVMNKYNLFENITQTIARTMETASGADAQAILEDMEDLKVRVIRRLSIASSQH
NSSNETTSLAGSYKSSALSAAALTDTSLETCALLSDPDYRTLASEDNHRRTSSQAPPSPH
PFPPARRRPLPLADDASSVACKCGTLYRDGSTSDGGAARCVACGPASGPGAVVTGTGAGS
DRGPVSHNGGGGGGTTSVTSGDEGDLDAAGASGVATVARHPSTGCSASSLSHLDAASALS
PDRRPRVHSPAGAGSTMASLTSDIPSDMADSFDGGISSSSLGDLDGDADFEDATSDSTDS
DV
Download sequence
Identical sequences A0A058ZEP4
XP_009492581.1.24044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]