SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059AFZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059AFZ2
Domain Number 1 Region: 184-471
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 2.26e-111
Family Enolase 0.0000000336
Further Details:      
 
Domain Number 2 Region: 47-179
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.53e-52
Family Enolase N-terminal domain-like 0.00000497
Further Details:      
 
Weak hits

Sequence:  A0A059AFZ2
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059AFZ2
Sequence length 474
Comment (tr|A0A059AFZ2|A0A059AFZ2_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW52581.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_J01952 OC=Eucalypteae; Eucalyptus.
Sequence
MSVQEYLDKHMLSRKIEDAVNAAVRAKTPDPVLFISNHMRKAVPSVITKIKARQILDSRG
VPTVEVDLYTHKGMFRASAPSGDQTGMYEAVELRDGDKGVYLGNSVQRAVRNINEKISEA
LIGMDPILQSQIDQAMIDLDKTEKKGELGANAILAVSIAACKAGAAEKEVPLYKHIADLA
CKPDLTLPVPSFTVISGGKHAGNNLAIQEIMILPIGASTFEEALQMGSETYHHLKAVIME
KHGAQGCNVGEDGGFAPNVSSLREALDLVKEAISRTGYNERIKIAIDVAATNFCIGTKYD
LDFKFPNKSGQNFKSGEDMIDMYKELCSDYPIVSIEDPFDKEDWEHVKYFSSLGVCQVVG
DDLLMSNPKRVERAINESACNAFLLKVNQIGTVTEAIEVVKLAKDAHWGIVTSHRCGETE
DTFIADLSVGLGTGHIKAGAPCRGERLAKYNQLLRIEEELGDQAGYVGEDWKLS
Download sequence
Identical sequences A0A059AFZ2
Eucgr.J01952.1|PACid:23599993 XP_010033045.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]