SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059ART8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059ART8
Domain Number 1 Region: 307-597
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.46e-75
Family Protein kinases, catalytic subunit 0.0000821
Further Details:      
 
Domain Number 2 Region: 4-254
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-57
Family Legume lectins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059ART8
Sequence length 649
Comment (tr|A0A059ART8|A0A059ART8_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW56454.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_I02186 OC=Eucalypteae; Eucalyptus.
Sequence
PVEALGFQFSTFDPSADYGALEVKSPALIYNDALQLTPDSSSGTVDFMNKSGRILYKQGF
KLWDGPPEAPTKIASFNASFVINIFRINNGTPGEGLAFIVAPDLNLPAGSFGGYLGLTNA
TTDGQASNHLLAVEFDTFKQDYDPDANHIGLDINSVESNQTVQLADHGFDLAPNHTVFFH
VWIEYDGGQELLEVYMIDEDEPTPTKPKPASPIMTASLDMSKVVNQNSYFGFAASTGDNV
ELNCVLGWNMTVEELPKGTPAGLVIGLAVGIPAAALAVAGVAALGVWAWRRRAAARDPNI
VGTLKSLPGMPREFKFKDLKMATGNFDEGNKLGQGGFGVVYKGVLAAENRQVAVKKFSRD
ELRSKDDFLAELTIINRLRHRHLVPLLGWCHQTGMLLLVYDYMPNGSLDGHIFCGPERQT
LEWSHRYKIVAGVGCALHYLHEEFDQIVLHRDLKASNIMLDSNFNARLGDFGLARAIDDE
KNSYAELEGVPGTIGYIAPECLHTGKATRESDIFGFGAVILEVVCGQHPWRRAGFDGFQF
LADWVWSLHRDGRILEAVDGRLGGDYAVEEARRLLLLGLACSHPIAAERPKMPAIVQIRS
GSMEVPRVPPFKPAFVWPSAGLLSEDGDTTDVTPMTSSSRFGSGWRSRD
Download sequence
Identical sequences A0A059ART8
Eucgr.I02186.1|PACid:23596908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]