SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059CC89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059CC89
Domain Number 1 Region: 241-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.78e-76
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 2-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.96e-45
Family Legume lectins 0.000064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059CC89
Sequence length 560
Comment (tr|A0A059CC89|A0A059CC89_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW76068.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_D00436 OC=Eucalypteae; Eucalyptus.
Sequence
MRLWDKATGNVADFTTQFTFVINSLGESSAADGLTFFFVPRGSQLPVNSSGQFLALVDPN
RDPSNSSTSFVAVEFDTFRNNDPHFNVVDPYCSQSRVAHVGIDLNNLTSAVSSCVDWFTD
KIMNGGRINAMIAYNSSTQNLSVLMIDADATGANIKSSAIYSIVNMTKYLPEWVTFGFSA
TTGTYFELHTIEAWEFSSNVQVTGTKTFIWFRQRSKRKRAYMSGEEDDPAIEEEFEQGLG
PKKIPFKDLVVATENFAIERLLGEGGFGRVYEGYLTSVNANVAIKKINPGSRQGIKEYAS
EVKTISRLRHRNLVQLIGWCHEKKELLLIYEFMFNGSLDFHLFKERTFLSWEKRYKIVQG
IASALLYLHEEWEQCVVHRGIKSSNIMLDSDFNAKLGDFGLARLVDHARGLQTTVLARTN
GYMAPECVYTGKASKESDVYSFGVVLLEIACGRKVIEPRANEGQVRLVDWVWELDGTGRL
LDAADSKLGTDFVEKQLECLMVVGLRCTHLDHAARPSIRDASNVVNFEAPLSSITKVSTF
STSSMQSSRSASSALLANAG
Download sequence
Identical sequences A0A059CC89
Eucgr.D00436.1|PACid:23574214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]