SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for A0A059D5W6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059D5W6
Domain Number 1 Region: 222-346
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.45e-31
Family Ribonuclease H 0.0025
Further Details:      
 
Weak hits

Sequence:  A0A059D5W6
Domain Number - Region: 86-134
Classification Level Classification E-value
Superfamily L9 N-domain-like 0.00131
Family N-terminal domain of RNase HI 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A059D5W6
Sequence length 367
Comment (tr|A0A059D5W6|A0A059D5W6_EUCGR) Uncharacterized protein {ECO:0000313|EMBL:KCW85816.1} KW=Complete proteome; Reference proteome OX=71139 OS=Eucalyptus grandis (Flooded gum). GN=EUGRSUZ_B02559 OC=Eucalypteae; Eucalyptus.
Sequence
MNYLSRVPSYTAAISKRAARLIGGRPFVERASAPAWGGAFRNAALRSANSEPVLCRYGVR
CYSSKRGKRAGSKSATAAVVDPEKDSFFVVRKGDVVGVYRSFLECQAQLGSSVCDPPVSV
FKGYKMSADSEDYLTSRGLKDAIYTINIADLKDDIFGMLTPCPLQEPAAYRGEDTETNGP
KETSHDALEEEVSVTVSTDPSVKHVSSNLNYEGVPISLNCNSCILEFDGSSKGNPGKAGA
GAVLRAEDGSVICVLREGVGTATNNVAEYRAVILGLKYALEKGCRSIRVRGDSKLVCMQV
QGLWKVRHKKMSELFQVVNKLKQNFHSFEISHVLRGLNSDADAQANKAILLADGQIEEEC
VELVQMA
Download sequence
Identical sequences A0A059D5W6
Eucgr.B02559.1|PACid:23567739 XP_010046450.1.83385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]