SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A059UGY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A059UGY9
Domain Number 1 Region: 2-58,85-253
Classification Level Classification E-value
Superfamily gp120 core 4.51e-53
Family gp120 core 0.0001
Further Details:      
 
Domain Number 2 Region: 301-419
Classification Level Classification E-value
Superfamily Virus ectodomain 2.47e-43
Family Virus ectodomain 0.00000772
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A059UGY9
Sequence length 601
Comment (tr|A0A059UGY9|A0A059UGY9_SIV) Envelope glycoprotein gp160 {ECO:0000256|SAAS:SAAS00936864} OX=11723 OS=Simian immunodeficiency virus (SIV). GN=env OC=Lentivirus; Primate lentivirus group. OH=9598
Sequence
AACTGLMNTTISTGIGINGSRAENRTEIWQENGNSNDTVIIKLNKYYNLTIRCRRPGNKT
VLPVTIMAGLVFHSQKYNTRLKQAWCWFGGNWTEAWKEVRETIAAMPNTTYTGTRNISQI
YLQRQWGDPEAENFFFNCQGEFFYCKMDWFLNYLNNQSVDADHNACNKTGDKKCWQRNYV
PCHIRQVVNDWYTLTKKTYAPPREGQLECTSTATALYVELNYNSRNRTNVTLSPQIRSIW
SYELGDYKLVEIKPIGFAPTKVRRYTGPERQKRVPFVLGFLGFLGVAGAAMGAAATALTV
QSQQLLAGILQQQKNLLAAVEQQQQMLKLTIWGVKNLNARVTALEKYLEDQARLNIWGCA
FRQVCHTTVPWAFNNTPQWDNMTWQEWEKQIAHLEGNISKTLEQAHEQEQKNLDSYQKLV
SWSDFWSWFDLTKWFGWMKIGFLVIAGIIGLRIVMIVIGLLRKFRAGYAPLSSLPSYNQQ
IHIHLDKGQPDKEEEPDKGGPSSDSRSYTWQREFLNHLLSNLISWLRNLINWFLIIWQTL
LSPLRRCLETTQQETRTVTAYLEYGWQEFKAAAAAFALAVAQAARSAGDSLRHAVRSTYM
A
Download sequence
Identical sequences A0A059UGY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]