SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060RM43 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060RM43
Domain Number 1 Region: 70-357,380-416,443-467,500-519
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.14e-80
Family Duffy binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 834-937,976-998,1126-1222,1274-1323,1347-1451
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.97e-66
Family Duffy binding domain 0.00096
Further Details:      
 
Domain Number 3 Region: 1818-2125,2153-2172
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.62e-66
Family Duffy binding domain 0.0000671
Further Details:      
 
Domain Number 4 Region: 2224-2494
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-59
Family Duffy binding domain 0.000097
Further Details:      
 
Domain Number 5 Region: 1474-1691
Classification Level Classification E-value
Superfamily Duffy binding domain-like 1.7e-26
Family Duffy binding domain 0.0044
Further Details:      
 
Domain Number 6 Region: 553-772
Classification Level Classification E-value
Superfamily Duffy binding domain-like 3.01e-21
Family Duffy binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060RM43
Sequence length 3000
Comment (tr|A0A060RM43|A0A060RM43_PLARE) Erythrocyte membrane protein 1, EMP1 {ECO:0000313|EMBL:CDO61730.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_0036500 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MAPAGRGGGDAARKKEEEEAHKYEQATSAKELLDRIGETIQKQVKREAADFRNYLKGDLS
QATFEKKPQSQQAPAKPCDLNHEYHTIVTTGHGRENPCKDNPDVRFSDTEGAQCNRSKIK
DNKSKEGACAPYRRLHLCDHNLENINDYVHITNHTLLADVCQAAKFEGESLTHYREEHQK
IYPDSSFQICTVLARSFADIGDIIRGRDLYIRNRKENERLENNLKRIFKKIHEDVTTSTS
GKKSDSALKTRYGGDENYFQLREDWWDANRKEVWDAMTCDAVSGSNYFRQTCLGNSSTLK
NCRCFADVDPPTYFDYVPQYLRWFEEWGEEFCKKRKKQLQNAKEQCRKGDNGEDIYCDLK
GFDCQRTKYKNSFFVEDTDCKKCSVACDNFMNWIEDQHKEFLKQRNKYQTEIKKYKNGES
RAGGRERRNTSTTKYDGYEKHFYEILERNDVGGLNKFLEKLNNETDCQKFDIKEGTIDFK
TVDVVGSASGSSSGGDGINSDSNKSNKTFAPTEYCDRCPECGVEKTNNDGNDKWKAIQED
CSKENTKTFNRTGTTEIPRLTPEQGKKGILGKYSKLCSSGKNGDQIETWECHYEKKNEED
KSGESGGSNICEKKKTEQNTKGHDVTSYYSIFYGSIIDMLKESIEWRDKLKKCIENDSQQ
CVNKQCKGNCECYKRWVEGKTEEWAGITTHFGKQEDLLHDIEDATDREQFFEYYVNQEFL
EDMQEAKGDRNVIKKIEELLKKKEEGVGDMTKAKTIIDLFLNEEEGFVTECLQKNPKECP
PPEDPSPARSENFEEGPSPRADDEDDEEDDEEDDNVEGEEEKGSSNTEEVVEETVAEVTP
KAEVKPCEIVKELFTRGNFDDACNLKYGKTAPTNWKCIPTTKTNSDGSKDGVRGPPGEKT
TTSSDSSSSGAICVPPRRRRMYIGPLIKWADEATKNTGVSSEAAGSGTSSEKSTEGEVQA
TQLQDVEGKTPSQPSDKLRNAFIQSAAVETFFLWDRYKKIKEKEAEEKQRRDQESNGLGG
LGLSPELQPRLIPGGVNEMAAAVGAGLPLGPEDSSTVLRELQSHVVSMSSGSSTGGNTIF
DEKDFNNRASSTPQRTRLQITGGLTPSLPTSDSDDDNNPEKQLKEGKIPNDFLKQMFYTL
GDYRDILFGDTDIVVKALSEEDQKAMKTINDKIEQLLPKNGTPRPPKPDTQEKNSGQSRH
TWWSQHAQHIWNGMICALTYTDSQEKDGKPQKVDGLYEKLFENATKNPKNDNDYENVKLD
NSDDTKARTGNDQPTKLKNFVKRPPFFRYLQEWGDDFCRERAKRLEQIKHECRNIDKPGR
QYCSGDGYDCTDYGALRHKNMFAQLDCKDCHIQCRKYRKWIDLKFQEYHKQEKTYGGERG
KLTNGNCSGDNTKFCTEIKAKNTAPDFLAALKHCKDGHNASHEDQDEKDNKIDFDNPEKT
FSRSTYCKACPPNEVKCNGGSRRGATSGCTPDNENKWDTVFSGITGNGTTITVQIIDRRA
PYMKDGSKQSLFKDSYLFKGVRTQEWECRFKEENKDVCKLKNFNNDIDLNDYTTFKVFLE
YWLENFLDGYYLLKKKNKIDLCTQEEKNTCDEETKKNCACVKEWVAQKTTEWGEIKKHFN
KGQYANGDNIKSKVKMFLETFIPQIALTKGKEKISDLSTFLKFYGCSDTDSSQKDIIDCL
IENLSKEATSCETLNPSDQTSPTCDNTPTLVEDTDTLDDIHPDDIEKPGVCNTVDIPVEP
PSLTCVEKIAKELREEAEKNAKTYDPSLKGTVLDFKSECNMVKKENNGGGVSGEKSCKFE
DTYKKSVETLKETCKGNGKERFNIEQQWKCVKIKKIGKDLCIPPRREHMCLEDLNYVGRY
YISDSNDLLKKVQKAAKREGDDIIRNLLKQNSCDEHRICDAMKYSFADLGDIIRGRDLWN
KNSKQIGLQTRLQYAFINIHDKLEKDKSKYENDKPKYLQLRSDWWDTNRKEIWKAMTCNA
PDAAKLLKKNENGNTTTTSLKVNCGHDFDPPDYDYIPQPFRWMQEWSESSCKLLNKELEN
FKNECEDCKNNGITCGGDKNGEKCKKCKKQCENYEKLINKWKNQFDKYKEAYKEIYNNDT
NNKANISSEPYFKNFLENLKTQCNEKDSADKYLDEASHCTKSKFNNDSDSNNNKDDYAFK
DPPQGFEQACKCDAPDPLEECPDNNKHVTVCTNLFPTKLCVSKSFNNDYDIWTSSFVQKS
SGKYAGVLVPPRRGQLCVKNIRLRSIRTKEDFQKKLIEAAYNEAFFLSEKYKDKEKALHA
MKYSFADYGDIVKGTDLISTVTLDKLKTKLDEIFKTNDGNVSSENRGKWWTNNKRQVWHA
MLCGYQKAGGGKIEAEDCTLPDDETDQFLRWFKEWSEHFCARQQKLYEEIQKKCESAKCD
SINGIMVPEDCQESCTQYRDYVTRKIQEFRLLNKQYNMNFKEKLAPDKYAPEYFKAKCNS
KCECLSKYIDIEKQWKNMYDSFHDNELKKKCICTKIRPKIPPKIKKTEDENVPVVPKQEE
DQIKPASPPPPKSDDILPPQPSDNTSDILQTTIPFGIVLALTSIAFLFMKKKTKSPVDFF
SVLEIPQNDYGMPTFKSSNRYIPYASDRYKGKTYIYMEGDTDEEKYSFMSDTSDITSSES
EYEELDINDIYPYTSPKYKTLIEVVLEPSKRDIQNDIPSGDTPNNKLTDNEWNQLKKDFI
TNILQSEQNDIPNNNIGANIPLNTQPNTLYFDKPEEKPFIMSIHDRNLLSGDEISYNING
DVPINTNISTTTNNTTNDSTSGKNDSYSGIDLINDSLNSGNQPIDIYDELLKRKENELFG
TNHVKHTSTHNVAKPTNSDPVMNQLELFHKWLDRHRSMCEKWDTNNKVDILNHLKEKWEN
ETHSGNKTSGNITPTSDIPSGKLSDIPSGKLSDIPSGNKTLNTDVSIQIDMDDDPKNTNE
FTYVDSNPNLTLPSNPNLVENNINPVDENPPIPNQVQIEMSVKNTQMMEEKYTIGDVWDI
Download sequence
Identical sequences A0A060RM43

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]