SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060RMP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060RMP6
Domain Number 1 Region: 10-37,104-136,297-404,484-666
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.38e-57
Family Duffy binding domain 0.00075
Further Details:      
 
Domain Number 2 Region: 655-880
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.05e-40
Family Duffy binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060RMP6
Sequence length 1526
Comment (tr|A0A060RMP6|A0A060RMP6_PLARE) Erythrocyte membrane protein 1, EMP1 {ECO:0000313|EMBL:CDO62085.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_0012200 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
SVEKSGSSSSSGSICVPPRRRRLYIKKIQDWAESQGKGDKQVEGEGKGGSSEKSQANGES
SDSSGRDGQKTPVSSGRDGSSEQSGQVKANDQGAGSGDGKPGGSDGQTATQPPDPLLEAF
IQSAAVETFFLWDRYKKEWEHKNKPQNGGLLGLSGGVGTYSEAMGGWGTGSQSGSSVGGI
FGNKDPSQLAGARAGPRLQFGAGLGGTPGGFPGGPYPQGLGLSESSWTAAAEPGAQRSLF
NTDEGTSQTGELDGNLLNNRLQLRTPSQPQQSQLQPLSLTLDSDPENTPPQTLLASGNIP
PDFLRQMFYTLGDYRDILVGNVPHGIDKVSATVDDQKEKDASGKESDMKKIKNALNSYFS
NSENQSQSRVNTPSQPSDKTRQTLWGDFAQNIWHGMICALTYEDKSEIEAKKPDGTTTLQ
RNNDVYNKFFGDENKTDKPTPSTNTGTFYKEYQYSVVKLSDKDSDSTGPKTVGPNGDSPT
SSTATGSTTLADFTSRPAYFRYLEEWGETFCRERKRRLDKIKHECKVEENGDRRRGGNGG
TKTPKCSCYGEDCDEISKQNYDIISNFKCPKCGKYCRLYKRWIRKKKEEYDEQEKAYNTE
LESAKSNNGAKEFCGTLGKDAADFLKRLKNGPCKNNNDDNENRKGKTIFDNIGDTFKPAK
NCGTCSKFSVNCKSGKCDNEKGTNCRNKNSISAEDIETMVNSTDDVSMVVSDNSGNGNGF
ESVLPECTNVHIFNGIRKDVWKCGYVCGVDVCEQTNVNEGTDGKEYIQIRALLAHWVHNF
LEDYNRIRTKLKLCTNSGEQTICIKDCGEKCTCVEKWINKKRDEWPNIRDRYVKQYNGGD
TEKKTLVRNFLEDLQSQIDVNKSIGSSAELRDFESKICNCTKSSKTKDTDERDIIQCLLD
RLQQKAEKCQKQHIGEPNQPCGDNSAPKQTPPEEPFEEEEDPENQVEKPNICGDMKTTEE
KVVDDKCEEEKNPSSTVTDEEGKEKTEEAPSAPPSTPSPTEGPDQDIDNKPKENQVTEDK
SQPRGEKKTNQQPTPQVVPPKPPVEKNPFNHPHVQTALASSTLAWSKKTTRPVDLFSIME
IPQNDYDMPTLKSKNRYTPYKSAQYRGKRYIYIEGDSGTDSGYTDHYSDITSSSESEYEE
LDINDIYVPGTPKYKTLIEVVLEPSKRDTQSDIQNDDTTTNKLTNIEWNQLKDEFISIML
QNEQNTEPNDYTSGDIPTNTNNTTPSHDNVDNNTHPIPSRDHMYQKPFIMSIHDRNLLSG
EEYNYDMSNNSGIYPSSSNRHSLSGTKNPISDNRDSYSGKNNTYSGTDLINDSLNSGNQP
IDIYDELLKRKENELFGTEHKKKNTSTNSVAKNTYSDPITNQLNLFHKWLDRHRNMCEKC
SNKVEMLDKLKEGWDNDNNNNSGNKTSGNITPTSGIPSDNNMHSDIHPSDIPSGNKTLNS
DVSIQIHMDNPKTTNEFTYVDNISPNLVGHPKPVDENPTNPNLVGNPNPVDENPTNPNPN
HVQIEMDVNNHKLVEENYPIRDMWDI
Download sequence
Identical sequences A0A060RMP6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]