SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060RQ62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060RQ62
Domain Number 1 Region: 378-421,457-482,537-559,697-814,881-925,954-1053
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.85e-62
Family Duffy binding domain 0.00098
Further Details:      
 
Domain Number 2 Region: 12-230,290-310
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.88e-54
Family Duffy binding domain 0.00032
Further Details:      
 
Domain Number 3 Region: 1043-1263
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.22e-37
Family Duffy binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060RQ62
Sequence length 1400
Comment (tr|A0A060RQ62|A0A060RQ62_PLARE) Erythrocyte membrane protein 1, EMP1 {ECO:0000313|EMBL:CDO61538.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_0017700 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
QNKDKNSLNGLKEDKETTCRAIRYSFADIGDIVRGIDLWDKNSDAETLQGHLKKIFGHIH
KSHKKKYTTDKETTKPPYKQLRKDWWEANRETVWKAMQCHTRDMNCESGTPYDDYIPQRL
RWMTEWAEWFCKAQTEAYGKLMGACGNCKDKIKSDKSCTSDEADCENCEKACTEYKNKIE
TWKQQWDKMQMKYEPLYSQAKNPYPGAAFGGADNQQMVDFLSKLHAASVAASGKDVKITG
VTAASPITPYETIAGYIHQELPITGCLEQKEFCDKKNGVKPTPGGAKVNTNEKYAFKKPP
PQYKDACDCKAPQQEGACRSATITPDGPPAESTSDSEHDNHDESGDDSDEEEDEKAKEPQ
EDNNTVDQGEGPQDKGKLPCEIVEELFKKTENLTQACQQKYQNGKERLTQWKCIPTTSGS
NTTGEGSEGGTESDVPANRRRRQAPSTPSDPNGKDKGAICIPPRRRRLYIGPLSRWAKTQ
TDKSQGEGSKTVEGQESVSESSGSGSSGQGAHTEPAAKVTQTEVSGQSTPSTSQSPSDLL
TAFVESAAVETFFLWHQYKQLHKTEDGDGLVGTYIGGVAQIKPVSQLEGGRAGPQGIRGP
GVIPPVLGPRAPRAPRAGLLGQQDKSSSWAGSGAVSHLGGPGSRDDDSSQPSSQGVFDGR
LSGRGPQTLPKVPGVGDGEEEDEENPDTDPETSLKKGKIPDEFLRQMFYTLGDYKDILFS
GSKDEKSSTYNDILKGDKEIQQREKDIKNAIQKYFQNSVTSPSTGGTLPSTSVTTPSNSV
KQTPQTSGTTPSSWWSNNAESIWNGMICALTYKENDTDTGPMTTEGEKTNTQITQIENSQ
ALLAKLDKEKGGEYHYENVKLEDTSGDTQARAKYDSASGDKTPLTEFVERPPYFRYLEEW
GTEFCVKRKDMLEKIKEDCTEDDRDGKLKQKYSGDGESCETILSQKYDILPSLSSSCPTS
CSSYRRWIGRKRTEYDKQQNAYCDQKTKCKEGSDKAESGNEFCGTVQSLSDAAAFLQKLG
ACKNNDSESGQGTLDFSENGDAFKDADNCKPCSQFKINCDKGNCDNSNGNNCNGKNKKDI
TPSDIKNSTDELDMVVSDSGKNGSQNGLQDCITSGIFTGIRKDVWTCGNVCGYNVCKPKN
VNGKKGDGKQIIFIRAFFKRWLEYFLQDYNKIRKKLKPCMNNSDGSTCINDYDKTYNCVD
EWIKLKMAEWKKIKKHYLDKNPEGDTEMISLVSNFLGEVQPQTDVTKAIKPCTLDNFEQS
KYCAVDASSEKAGGKDGRSKDIVDCLLYKLQKKIDECNKNHETSGESCTGTLQQTPPLPD
EEETEEENPENKVEKPAICGNIPTTEDTVDEGDQCKPADEKVAENEEDGTAESGEGNSPP
APPEPAPSSETSNPEQTPVL
Download sequence
Identical sequences A0A060RQ62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]