SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060RQZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060RQZ8
Domain Number 1 Region: 437-737
Classification Level Classification E-value
Superfamily Duffy binding domain-like 7.32e-63
Family Duffy binding domain 0.000000000104
Further Details:      
 
Domain Number 2 Region: 156-406
Classification Level Classification E-value
Superfamily Duffy binding domain-like 5.36e-54
Family Duffy binding domain 0.00000000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060RQZ8
Sequence length 1640
Comment (tr|A0A060RQZ8|A0A060RQZ8_PLARE) Erythrocyte binding antigen-175 {ECO:0000313|EMBL:CDO63764.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_0728300 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKCNISIYFFSSFFVLYFAKARNEYDIKENEKFLEVYKEKFNELDKKKYGNVQKTDKKIF
SFIENKLDILNNSKSNKRWKSYGTPDNIDKNMSLINKYNNKETFNNNYQSFLSTSSLIKQ
NRYVPINAVRVSRILSFLDSKINNGRNTSSNDGDLRNCREKRKGNEWDCKKKNGTSNYVC
IPDRRIQLCIVNLSIIKTYTKETMKDHFIEASRRESQLLLKKNDNNYNSKFCNDLKNSFL
DYGHLAMGNDMDFGGYSTKAENKIQEVFKGVHGKISEHEIKNFRKKWWNEFREKLWEAMI
SEHKNNLSDCKNIPEEELQINQWIKEWHGEFLSERNNRLKLPKSKCKNNTLYEACAKECI
DPCMKYRDWIIKSKFEWHTLSKEYERKNVSNKDAEKYLIKFSKNNDAKVSLLLDKCDAEY
SKYCDCKHTTTLVKSVLNGKDNTSKEERETIDLDDFSKFGCDKNSVDTNRKEWECKKPYI
LSTKDVCVPPRRQELCLGNIDRIYDKNLLMIKEHILAIAIYESRILKRKYKNKDDNEVCN
VINKSFADIRDIIKGSDYWNDLSNRKLVGKINTNSKYVHKNKENDKLFRDEWWNVIKKDV
WNVMSWVFKDKTVCKEDDIENIPQFFRWFSEWGDDYCQYKLKMIDTLKVACEEKGYDDIT
CKNKCSSYKDWISKQKYLYDKQVTIYKEYQRNNNRIYPIVKTMEPKVYLKEYSKKCSNIN
FEDEFNEEVHSDYKNKCMISTKVLDVPIPAEKNVTEALETVVPKENTEIERKNESDTEEQ
KNQEIPNNYLKDSQQRVGENGTKVSSQEDLRGSRNEEGVTQEFGLNDEIPKGEEQISGKS
GVIQNRSESEMGISTSEESRHEEGHNEQTLSTSVDQSELSDTLQLHEDTKENDKLPLESS
TITSPMESGSSDTEETQSISEGPKGNEQKERDDDSSSKISVSPEISRTETHDKDTSNLLR
LKEDVDISMPKAVIGKDPNDHINNTAEGDHISGVNSSPLSDGVRPDKKELEDQNGYESEE
TVGDYKSKSPSENIRNDSDSESVAISESSSSNTGLSIDDDGNDGTFVRTQDTENTEDVIK
EENTEDVIRKENTEDVIKEENTEDVIKEENTEDVIKEENTDKDENEKGADEEIHSTSESL
SSPEAKMLTDNEEGNSLNHEEVKEHTSNPDNVQQSGENVNMNVENQLKDTLENTSSSLGE
GKAHEELSEPNLSSGQDMSNTPAPLDNTSEETTERISNNEYKVNEREDERTLTKEYEDIV
LKSHMNRESDDDELDGKNSDVPTVNDESEDVEEKMKRNDTSEISEDSSQHIENDQQENDM
KTVGDLGTIHVQNEINDSVTGENKEQTVHGDEGVRLSHKDIHKINLEDKNSNILHLKDMR
NEENERKQLANQNINISQQRDLQEHGFHTMNNLHGDGVSEGSQINHGNPVKRQDRGKPSG
NVLNMGSNNNNFNNIPSRYNLYDKKLNLDLYVNRNDSTTKELIKKLAEINKCENEISAKY
CSDMIDKEIPLKTCTKEKTINLCCAVADYCLSYFTYDSKEYSNCTKREFEDPSYTCFRKK
GFSSMPYYAGAGVLFIILVIVGASQAKDQSSDEVLNENNENNFTFEVTDNLDKLSNMFNQ
QVQETNIKDFSEYNEDINAC
Download sequence
Identical sequences A0A060RQZ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]