SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060RRI2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060RRI2
Domain Number 1 Region: 418-721
Classification Level Classification E-value
Superfamily Duffy binding domain-like 2.75e-51
Family Duffy binding domain 0.0000242
Further Details:      
 
Domain Number 2 Region: 107-395
Classification Level Classification E-value
Superfamily Duffy binding domain-like 6.02e-48
Family Duffy binding domain 0.000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060RRI2
Sequence length 1500
Comment (tr|A0A060RRI2|A0A060RRI2_PLARE) Erythrocyte binding antigen-181 {ECO:0000313|EMBL:CDO62124.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_0100400 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGKMNMCLFFFYSLLYLILCAYVLGIGEEELKERPQGLNDKNNDNYNNNSKDLMSFANE
VVRFMENEKDVEEDKNVNIISGPVENTLNRYTGSSFLNIKKYGRKGEYLNRSSFFQRSYV
NGCQEKRKSHTWVCGNEGNDNICIPDRRVQLCITSLQDIKNSGSEKNDRELLKNKVFDSA
MYEADLLWNKYGFRGFDDFCDDVKNSYLDYKDVIFGTDLDKNNISKIVEEALKRFFKKDS
SILNPHAWWQRYGTRLWKYMIKPYEHLGCKKPDEGEPQINRWLKEWGKYNCKLLKEKEKS
LIKECAVNKRKTDCSRKCNNECYTYRNFINRQKYEINKLGKNYVKVIRYNIFNRKIIPPN
NALDFIKLNCSECNDVNFKTLFEFEYGKYEEKCMCQSYIDLKIQFKNHGICLFNAQTDTV
SSDKRFCVEKKESKPWQCDKNSFEKVHAEGVCVSPRRQAFCLGNLSYLLSDDIYKVHNSQ
LLIEILMASKQEGKFLWKKHGITFYNNYACKYINDSYADYKDIVIGTDLWNDKNSIKAQN
NLNAIFERNFGYKVGRNKLFKTIKDLRTVWWILNRDNIWESMKCGIIDVDRRGYSCVRMN
ELENMPQFFRWFSQWAHFFCKEKEYWELKLNDKCKDTKGNSLCKEKTCQNVCTDMNYWTY
TRKLAYEIQSLKYNKERNLYSFSKDKNVSIFLKENTKNCYNIDFTKIFDQLDKLFKERCP
CMDTKRLEVKNKEMLSIEANSEEEEELQGNNNSVSVISGNKGTNSDTKVIVKDKNEKQQE
KEAKQTTGSLTVQTNEDSDSKKGKSTATDTKNSFEKLEVQKDATNGETIKEEHPELPQSP
ENSQTQEQEKSESDQPRTGQETGEQNEISSGQEQNEPSSSTEVVSQETTSENASPQDTEK
LSTEPKDNSVVVNKETSSKDLAHEMVDEEQDKHPNTNIGKDVSLKTDKQEEQDAISPLQS
TVSSTESAEPKVQSTPSTDSPTVEGENTESLRSPHVADNSESESGLNSTDDFKTTKDVVK
EQETLKGGESVSETLENSSEKPKDVDPSHEISESVPSGTTDKEEKDKLEGKSLEMENGTY
PGSNDEEDVTGPSVEDITNDDNNSFHNIANQSDVLNREDAIASETQVESEPEDSNRVITT
EVPSTTVTTTDEKLSEEVEEKEAEEIKEPVESRVIRETMENSANLDSPAHEEDVEKETLE
PEKNELYNDTSRGNISEKDLNDIQSLRTETDSTVLDDSSENGERTEDSESEVGILRKHNF
STEQNEEKDFDPVESDLEKEEIKNLLNLEKEEDADVEIIDRTHDSMSDGDNGDSNNNNLS
SEEKIEQYKNRDVSKEREEILNMSKTNICSNEHSLKYCQFMERNKDLLETCSLENRLHLC
CAISDYCLKYFNPNSLEYFNCTQNEFDDPTYNCFRKQRFTSMHYIAGGGIIALLLFILGS
ASYRKNLNDENGFYDSNVNDSAFEYNNNKYNKLPYMFDQQINVVNSDLYSEGIYDDTTTF
Download sequence
Identical sequences A0A060RRI2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]