SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060RTV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060RTV8
Domain Number 1 Region: 32-123
Classification Level Classification E-value
Superfamily Chaperone J-domain 8.64e-30
Family Chaperone J-domain 0.00025
Further Details:      
 
Domain Number 2 Region: 168-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.4e-22
Family PDI-like 0.021
Further Details:      
 
Domain Number 3 Region: 431-518
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000448
Family Thioltransferase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060RTV8
Sequence length 540
Comment (tr|A0A060RTV8|A0A060RTV8_PLARE) Heat shock protein DnaJ homologue Pfj2 {ECO:0000313|EMBL:CDO64898.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_1107200 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MNVTNVVKRRKKLSYFHSLLLIIFSFFLSCARGMDYYKRLGVKRNATKEDISKAYRQLAK
EYHPDIAPDKEKDFIEIANAYETLSDPEKRKMYDMYGEDYAQGGMGGGSPGGGEHAHGFH
FDQDVVNEIFKQFAGGGGAGGGAGRAGNFHFKFTSGGPSFNHFEDEYEDIYKNEVLKINS
KNIESVLNEISFSLIINFYSPTCSHCISFKKKYLKLRKKFDGYITFAVVNCQEENMLCRK
YNVKSLPQLILMKSDKTYETFYGNRTDENLTYFIKNNIPSAIIECNNQKKLDNFLTQNIE
IPKVLFFISHNDNIVMLKALSLEFKKRINIGIIYNTNYSVMKLFKKKNIKTPSLLLVDDI
DSLSGDLTQLKNFDFNILSLKLSHIVAQNRLKNNLYGHVTSYQELTKKKYESGQCHQKDS
QICFFILKLLKKNYKSFDEDIKKVANKFSSDPLKILYINIYQQPYILDSFGLSNNVPYSN
GLILVAFRPKRQKFKVYDGDVNVENVHKFVDNVVSGGISINQNIKRSLKFVHVEQYDDEL
Download sequence
Identical sequences A0A060RTV8
XP_012763497.1.2076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]