SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060RV97 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060RV97
Domain Number 1 Region: 3-237
Classification Level Classification E-value
Superfamily Duffy binding domain-like 4.45e-40
Family Duffy binding domain 0.0000841
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060RV97
Sequence length 4788
Comment (tr|A0A060RV97|A0A060RV97_PLARE) Antigen 332, DBL-like protein {ECO:0000313|EMBL:CDO65282.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_1146900 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MSNINKIDSSTEWNCKEDVGCVPPRRQNLNMERLDNENEDSVPAFMKKTFYRAAAGEGKK
LREKHDESCDKFCDAWNRSLADYKDIFQGKDMWNDGKYGEAKNHIKNAFGDVNNRKAMLN
EIEKGIKDETFSPENGLEVCKSQCEERSRDDTEDQFLRFFAEWEEEFCDGLNKHEEQLKS
CTKNINCDIKCSNFKDWLETKKDEYDIQSRVFEKKYANDNKSKHLNYLKEGMNKCKVKNP
EMVFKSGFANEAECRNLNVKDAGNKNSNNLKDLPSNSDKGGIVSESYKATKKNGESIMDK
IPKSFNKLFGYFSGSQEEEQKQNEVSHRNNYDNILVDKFHRSTLLDKLDDRMIIDELNRD
NIMEEVLSKIPEPIIREAPKYVPKKPVPPQHIPRGDNVRRNIDVNGSKDEYSPGTENTNS
KIKPTYEEKHEDKSKVSIETSEIDHDKEPFRISEEKKVVNEDVKELENIEYEFDETFDFF
DEDTKRNIDYIRQHMQSKIRKSVENYNSEKEEFKRNIETQLIESGDGMNAGNYSSALQDN
NTEIPTMVLVPGVLTVFLLTIIWVLVYKHSLIDRVHGTGKTKKEEKMKELESEEFPKEKY
NIEDMEETEKENEIEKKMDENKETEEPEEGSTEEFVQEKELNQETLESEIIVDHIKEEED
TRNVKEQESVLEESPIEELPVENNIGEINEEVEEFLLNEIPLEEQVPKELPQEEIEEIVV
EELPIDEHLSSEETTVTEEDTFKGQLINEELPVEEKNVSEEIPVEEKSVTEKLQVDEKYV
TEKLQVDEKSDSEKLQVDEKSDSEKLQVDEKSHSEKLQVDEKSDSEKVLLEEEFHGEELP
LDETKVSEELSEGGIAIEDVPVDEETVTEEITVDEKIYEKLPNEIETVNEEMHLEDETLT
EQISSEHERVPEEIIEEKPFTEGEETESLTYEIVEEGVVTDDIPEEQIITEKVQEEEESV
TEVLPEEGIINEKVQEEEESVTEVLSEEDIINESVTEVLSEEDIINEKVQEEEESAYQEI
VQDGSVTKDVEYKELVRQDVRDKENFVIEEDPFKGQLINEGLPIEEKFVTEEFPVEEESV
FEELTEEDQSVTKEIPVEEHSVFKEVDEIESVTDEIVEEEKSITNELVKEERTALEEIVE
QRPDTEEVEETEVVNEEVLKEEGSVSEKVVKEEGSASEEIVQEEVSTTEEVVEEEESSSE
EIVEEEESSSEEIVEEEESSSEEIVEEEGSVTEEVVEEDESISEEVVKEEGAVTDEVQVT
ESVEDEIIDQGIVDEVIVEQEASVTDEIVKEDGSVIEDIAVEETVTEIVEETKPMDQEIV
DQGSVVENVEEAELVTEEVVEQEGSVAEKVEEEELVTEEVIEREGSINEDIVEEESITDE
IKEQLVPEDIKEEQLDSEEIVAQRASVNDEKVEVASITEEVEEIESVNDEIVEEASITEE
VEEEEKSVSGEVLEEEGSSTEVVVEEKESVTEEFLEEESVSQGIVEKEGFANEGFVNEEF
VEEEKSVTDKLLEEESVTKEVGETELATQEVVDEKVSVTEEVIEEEKSVSEEVLEEGSAT
EEVVEEGLSSDNVQKSKGVIENVGEIYFVKTAKDESMNEKIPLEKSSFTDDESFKGQGPT
DNVSVEDVNSENIINAHTPLEETKIEESPTEYITTADIHTKGETETKYHLIYEKINEEVE
KAKFQEEKITENIPVERESVTEDIVQEPSLAQEVEQKESDTKEVEETKLVNEKIIPEGLG
TEEVLEEDESITEEIVEEEGSVDEEIVEEEVSASEEIVEEEGSFTEEIVEEEGSFTEEIV
EEEGSFAEEIGEEEGSFTEEIGEEEGSFTEEIGEEEGSFTEEIVEEEGSFTEEIVEEEGS
FTEEVEEEVSVDEEVVEEVSAAEEVKDIGSVSEEVLEEEGLVTEEFVGQQGSVIEEIVEE
ESATEKVLEDAGSNAEEIVQEEGPVAQEIVHEEVSTTEKHDDVDRSSTEEIVEKVGSVSE
EILEEEVSDSEEIIVEEVSDSEEIIVEEGSVTEEVVEEEKLINEVDETESVAEEVLGQEG
SMNEEILEKGSIVEEIVEQEGSVTEEIVDHGSFAEEVKEEELVAEEAVQNEGSINEEILK
EEGYITEEIKEEESVTENEAIEESAFAEIIEEKGPNTDEIVKEEGLDTEEIVNGVSVHGF
RFIEEEKLVNEEIVGEERSVTEEIVEDATAIEEIVEEEGSVIDKVVEEEKSFIEEVDKTE
SVTEEVLKEEELITEKPVEVEPSATEDLVEEEASVIENVLVHEGSMTEQILDESITKEIV
DKGSAIDETVENEGSVAEEIVEEEVSVDDKIVDDRSVPEEILEEELSGSEEVLEDEWVTD
AFMGQEGSVIEEIEEIVDEQGSITEEIVEDGSSNEKIVEEEASRVEEVLGKEGFVIEEII
EEGSVIEQVEDTKTVSEKAEESLAIEEVKEVKEEESISEKIVEKEGSVTEEIIEDGSVTE
EIIEDGSFTEEFVEDGSVTEEVVEDGSVTEEIVEEEGSVTEEVDETEYVTEEVEEEGSIV
EEIVEEEGSVTEVLDETESVNDEIVEEAPITEEVEESESIIESVSQEEETEKGFVIEEVE
ETGAVTEEIVQDGLITEEILEESESLNEETLEEGSINEDLEKTELVNEEIINKESVSEEI
LEREFLTEEVVGQAGSTSEEKVEEGSVTKEVEEKESVTEEIVDEGSVTEVVLQAGSIAQK
IVEEESSTEVVVEEEGQFTEEIAEEESATEEIVQDGSGIDDFVGQQGSVIEEVVEEEISA
TEENLKEEASAIEEFVEEESVREDVLEESLVTENVVGQQESVTEEIVDEEGSLTEKIVEE
EKSVTEEVEEKESVKEKVEEQRSITEEMIDEGSLAKEVEEQRLVVEEEGSATEEIVEDRL
VTEGIVEDGLATDEFVEQQGSIIEEVLEEEGSVTEEIVGEEKSIIEEIVEEKEELVTEDV
EEKESVIEEIIEEQLDDDEIVEEGSVTEDMIEEGLENEVILDEDSITEEALEKEGLVIEE
VVEEGSVNDEIVEEEGSVNDEIVEEEGSVSEEIVEEKGSLTDEIVKEEESVIEKVEEKES
VTEKIVQEGSVTEEVVEDEITKSITEEIVDDVSVNDEIVEDGLTTDDLVGQQGSVIEVVE
EVVENPVSVTEEIVEKEGSVTEDVGQEEGSVAEEIVEEQGFDNEEILEEESVAEEFVEEE
VFDNEEIFVEQISDSEVVKEENLVNEEVLEEEGSTTEYVEGAESVIEEAEEIKSGTKEIV
DEEISFTEEIVEEELVDDEILQEEVSATEDVIEEVRSVTDEIVQEESVCEEILGQEVPAS
EEYVDDKSVTDDFVGQERSVIQDVENTESVNEEIVEQKGSFTNEKLEEGCVTEGIEESQS
VIKEHNETESVAEEIVQEDASAIEEIDEIESVTEEIAEEDKSVIEEVVETESLSKDIEEE
KSIAQEILEETQSVNEEIVEEERYTDEVLKEKVLPSEVVEEQASTTEELVEERSATDEIV
EVEDLFTEEVKEREGSVTEEILEEGSFTEEIVEEGSDTEEIVEEGSDTEEIVEEEGSITE
EIVETESATEEILQGSVTEERVEEGSITEEIVEEEKSATEEVDERESVTEVVEEEGSFTD
EVVEEGSTDEVIENQGSVTEEILEHEVSAAENFVGQAVSVTEEVVEENESVTEEIEKSEP
VAEEIIKEESVTDEVEKEESVSEEVKEQKVSFAEEIVDKEASFVEKIVEEDGSVIENVIQ
QPDSVIEEIDIRELGADGVEEREKISTGDVEEVSSTEGLEEASSTGDVEEVSSTEGLEEA
SSTGDVEEVSSTEGLEEVSSTEDEEEVSSTEDEEEVSSTEDVEEEGSVAENVKETKSITE
EVSAEEDIISEKVVLEEETKSEEVSIREENVTEELPVDEKFMAEEVIVEEETVAEELPVE
DKITNEEITVEEETISEHLSLEEKIKSVEVPEEDIITEKVSVEQEAMDEAPVEEKIMTEK
LSVEDKSLNEQITSEEETVIEDGNVHEVVPVEVTVTEEIPVVEETTNNESHVKGENVVNE
VVVDDNSVNDEIHFNDDSSIEIYTVDSKDVFHKEENYDDSFREEVRSDENIHIFRKKIEN
EKSSVGYVPTEYTSKENIAEEVPSHIMFKENVTEEVPQEVKYEENTVEEVFEEVNSKENI
IEEAPADINSEENIIEEVPEVVTSEEIVVQNDVNNINTNIDHMFDFDLDAILKIPEAQKK
LSKLRRLVDVHLDVIEKTQRDEWNKTKRDFLYICLKEINKLSEDTLMKFYGSDSNKSAND
NDTVMVTQILKNKWGTGKIVDTIANSLNKSYNPLSHNLYIEIEKDLLRNKTETFNKWSKH
HWNKLDNWKEERWFKLFKRDLTIDMKKTYERDQNDEENNEESMNELSDELIKNNTSDNMR
SEQKTLEKNKEYSNLSEDLGLIEKQKIIWKSWIEKNVNNIENWFDEMWFKNVVNDLKEKN
NVSNELQENASEASVEYYISDIEDSKDITNSINYSEKSKIVASSSKTTNEKYIILSRKDL
IYNIIVMIHMMVLDQFKYDELKYAKKRFLNRSIDKFIKEKNIKDKETVLDYYIDDIIKLI
VEDSSHGNNIKKKAIAKYTSHDWFRLLHQENKSQNSISQEVNILKEKYKELISEEDNKKE
NNNNNVDVKPELKDNIKSEENVSFNIFRRSNKKDQLPLEEKKNKNGHLKNTLTENDGKKI
NINEAIEESKNGNEYKNSGNIEKSRKPRDRRTERKENDQDLRVQLLQDYENIFEQIQNME
NQNKDKNKKETNNILKTSIDLDKNILREYKKEKNIINESEKEFSVNEN
Download sequence
Identical sequences A0A060RV97

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]