SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060S207 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060S207
Domain Number 1 Region: 454-735
Classification Level Classification E-value
Superfamily Duffy binding domain-like 9.42e-66
Family Duffy binding domain 0.000000348
Further Details:      
 
Domain Number 2 Region: 148-421
Classification Level Classification E-value
Superfamily Duffy binding domain-like 8.63e-45
Family Duffy binding domain 0.00000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060S207
Sequence length 1285
Comment (tr|A0A060S207|A0A060S207_PLARE) Erythrocyte binding antigen-140 {ECO:0000313|EMBL:CDO65810.1} KW=Complete proteome OX=5854 OS=Plasmodium reichenowi. GN=PRCDC_1300500 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MKGYFNIYFLIPLIFLYNVIGINESIRGRTFYNRQDESSDISRVKSPELNNNHKTNIYDS
DYEDVNNKLINSFVENRSVKKKRSLGFINNKTRSYDIIPPSYSYRNDEFNSLSKIEDNSG
NTNSNNFANTSEISIGKDNKQYTFIQKRTHLFSCGIKRKSIKWVCRENSEKITVCVPDRK
IQLCIANFLNSRLETIEKFKEIFLISVNTEAKLLYNKNEGKDPSIFCNELRNSFSDFRSL
FIGDDMDFGGNTDRVKGYINMKFSDYYAEKNVEKLNNIKKEWWEKNKENLWNHMIVNHKE
NISNECATIPEEEPQINAWIKEWNENFWMEKKRLFLNIKDKCVENKKYEACFGGCRLPCS
SYTSFMKKSKTEMEVLTNLYKNKNSGEDKNKFLNDLFKKNDKTNLDDFFKNEKEYDDLCD
CRYTVSIIKSFLNGPAKNDVDTASKINVNDLRVFGCNYKSNNKKSWNCTGTFTNEFPGTC
VPPRRQTLCLGRTYLLHDGHEEHYKEHLLGASIYEAQLLKYKYKEKDENALCSIIQNSYA
DFADIIKGSDIMKDYYGKNMEESLNKVNKDKKSNEESLKIFREKWWDENKENVWKVMSAV
LKNKETCKDYDKFQKTPQFLRWFKEWGDDFCEERKEKMYSFESFKVECKKKDCDENACQN
KCNEYKKWIDLKKSEYDKQVEKYTKDKNNNIYDNIDEVKNKEANVYLKEKSKECNDVNFD
DKIFNESPNEYEDMCKKCDEIKYLNEIKYPKTKHDIYDIGTFSNTFGGRTPISINANINE
QQNGKDTSKTGNTETESDAGINVEKLSGDEKSSERREISDIKELSVTSNVNEASDALTLE
TEDTGENTLANLRKEDKSLLSTKNQTDLNGRSTLEEQTVHEQTNGSDTGVNVMTESNGSG
ITGRKKENEIDGGHNEVHAASNTQSSVSNTSDIRKEHSESSLNRTTDTQDIKIGSSGNEQ
SDNQKNNSHSSDDSDSLTIKHDPSEDNTQNIYDLQDSHKDTSNTLVSSQSDDEVNGIGDL
DSSGDSESGGGDTISKTHDVRPMNIVREKHVNNHDFIRSGMTNNNAHNQYITPNGNNGII
RGQEESDGGKVNSEHNRARSNFSFKNDHKKNIQEYNSRDTKRVREEIIKLSKQNKCDNEY
SMEYCTYSDERNSSPGPCSREERKKLCCQISDYCLKYFNFYSIEYYSCIKSEIKSPEYKC
FKSEGRSNIPYFAAGGILVVIVLLLSSASRLGKSNEEYDIGEVNIEAAFEENNYLNKLSQ
IFNQEVQETNISDYSEYNYNEKNMY
Download sequence
Identical sequences A0A060S207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]