SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060T512 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060T512
Domain Number 1 Region: 27-218
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.9e-24
Family Cutinase-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060T512
Sequence length 222
Comment (tr|A0A060T512|A0A060T512_BLAAD) Cutinase 2 {ECO:0000313|EMBL:CFW93880.1} OX=409370 OS=Blastobotrys adeninivorans (Yeast) (Arxula adeninivorans). GN=GNLVRS02_ARAD1B06864g OC=Saccharomycetes; Saccharomycetales; Trichomonascaceae; Blastobotrys.
Sequence
MKANLILACASLVAGVSAAPLERRDGGCSKYTIIDTRGTGELQGPSAGFITMNRNILSQV
PGGVEYDTIYPAGWSQISTQGTLDIVNKVQSTLRSDPDHCFVLEGYSQGAAATVSALPKL
TGDSFDAVKAVFLIGNPMHKSGLECNVDTLGGKSTAYANGLEAYLGGIPDEWVSKTMDVC
NFGDGVCDTLTGIGITAQHLDYPLDANVQKMGADFVVKALTS
Download sequence
Identical sequences A0A060T512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]