SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060WR45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060WR45
Domain Number 1 Region: 12-155
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-34
Family CRAL/TRIO domain 0.0025
Further Details:      
 
Domain Number 2 Region: 222-347
Classification Level Classification E-value
Superfamily PapD-like 5.76e-30
Family MSP-like 0.00000433
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A060WR45
Sequence length 411
Comment (tr|A0A060WR45|A0A060WR45_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ69507.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00007998001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MSRCVQTFDWYFWFKVKLHTKDAKTSMDKKKYVAFWLERYAKREPGMPLTVVFDMADSGI
SNIDMDFVKYVINCFKVYYPKFLSKMIIVDMPWILNAAWKIVRTWLGPEAISKLKFASKN
EIQTFIGPEYLPPHMGGTDPFRYSYPPLPDDDFQTPVCENGPIVSEDDNESKDFESDSKE
LESSFSSEVAIGPKKVYFSEESLSSLKLDDNDKGDSRPKGARKPLTTFKAPLLHVSPAEE
LSFGSKESDRKCLIILDNVSKNQVAFKVRTTAPEKYRVKPSNSCCNSGASVDIVVSLHGG
YQASLQDRFLVMAAEMEQNTGAGSPELAHFWKDVPKTKIMEHRYIIINASSWMGIYTDLT
VSMKQPHPPSSIKASSVQWCLIENNSVHDLSSLTPGEPRKISVCAISLYLF
Download sequence
Identical sequences A0A060WR45

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]