SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060XJU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060XJU7
Domain Number 1 Region: 110-160
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000101
Family Hairy Orange domain 0.0027
Further Details:      
 
Domain Number 2 Region: 36-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000484
Family HLH, helix-loop-helix DNA-binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060XJU7
Sequence length 270
Comment (tr|A0A060XJU7|A0A060XJU7_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ79517.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00012601001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MCGRDISDGQKMPADMMEKNSSSPVAATPASMNTTPDKPKTASEHRKSSKPIMEKRRRAR
INESLGQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALNTDPTVLGK
YRAGFSECTNEVTRFLSTCEGVNTEVRTRLLGHLASCMTQINAMNYPTQHQISAGPPHPS
FGQSMVQMPNSSPQGNVMPLPCKGGSPQSMSPEATKVYGGFQLVPATDGQFAFLIPNAAF
APNGPVNTPVPAAVSPGAPTGNSDSVWRPW
Download sequence
Identical sequences A0A060XJU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]