SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060Y1C1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060Y1C1
Domain Number 1 Region: 467-602
Classification Level Classification E-value
Superfamily TIMP-like 1.02e-24
Family Netrin-like domain (NTR/C345C module) 0.023
Further Details:      
 
Domain Number 2 Region: 238-334
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 420-473
Classification Level Classification E-value
Superfamily BPTI-like 4.4e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0023
Further Details:      
 
Domain Number 4 Region: 356-415
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000497
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.026
Further Details:      
 
Domain Number 5 Region: 156-206
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.04
Further Details:      
 
Domain Number 6 Region: 63-112
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000497
Family Elafin-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060Y1C1
Sequence length 639
Comment (tr|A0A060Y1C1|A0A060Y1C1_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ85277.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00042485001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MNISSLSRRGVGGGKNVDTNQPKALIYPKGLLSGHVGWSSLVFLVCLCVFPQQTRSASLA
GSKVEHPGVCPNKLNANLWVDAQSTCERECEVDEDCAGFEKCCTNVCGLFSCVAARFSDG
TPAQPDGQGRGEKGSGGQGSIATCQGFICSQQGATCDIWEGQPICKCQDHCEKDPSFTCA
SDGLTYFNKCYMDAEACTQGVTLTVVTCRFHLSGPQTSPLPQDTTANPTLTSFLEDPIPP
TLFSNPSHQSVYIGGTVSFHCDVMGVPRPAVTWEKQSERHESLVMRPDRMYGNVVITNIG
QLVVYNAQVWDTGIYTCVARNAAGVLRADYPLSVIRRTEDDIFSEDPEMAGMPMGPPFSP
ADCLAEVDRRECSAERYVDWYYDAEQGTCLAFSNGGCDDSRNRFETYEECQASCQREGMG
ICSLPAVQGPCKSWEAHWAWNSLLKQCQAFAYGGCQGNSNRFRSKKECEANCPQSKRRVC
KTCRVKGKIVPSLCRSDFAIVGRLTELIEDLDSGIARFSLEKILRDEKMGLAFFNTRHLE
VTLAKMDWSCPCPNITMEEGPLLVMGDVQDGMAVIQPDSYVRPISDKRLKRIHEVLEKRT
CEMLQSAFLSDTVFITQKNQARTFQTMPMLYITQSNRDV
Download sequence
Identical sequences A0A060Y1C1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]