SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A060ZAY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A060ZAY9
Domain Number 1 Region: 25-176
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.26e-21
Family Growth factor receptor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 179-233
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A060ZAY9
Sequence length 252
Comment (tr|A0A060ZAY9|A0A060ZAY9_ONCMY) Uncharacterized protein {ECO:0000313|EMBL:CDQ98874.1} OX=8022 OS=Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri). GN=GSONMT00003241001 OC=Salmoniformes; Salmonidae; Salmoninae; Oncorhynchus.
Sequence
MTKLTFVLLCHIISLRLTCREPRGCQGGCLTCSDYNGCLSCKPRLFIFLERNGMRQMGVC
LPSCPSGFYGTRSPDRNTCTKCRPECDSCFNKNLCMRCRAGYYLHLGKCQESCPESLVCS
DTQGNVFPVKCPADCDACLINDTCTRCRPGLYLLLGKCHHVCPDEFQPNDKLMECSLQVH
CAVGEWGEWSPCSRSGKTCGFKWGEETRTREVVQFPSAYGKLCPPIWEKKECVLKRRRCP
GKYYNNYTGDHQ
Download sequence
Identical sequences A0A060ZAY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]