SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061D7W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061D7W7
Domain Number 1 Region: 30-129
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.57e-28
Family Chaperone J-domain 0.00026
Further Details:      
 
Domain Number 2 Region: 184-285
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000092
Family Thioltransferase 0.045
Further Details:      
 
Domain Number 3 Region: 429-538
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000615
Family Thioltransferase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061D7W7
Sequence length 547
Comment (tr|A0A061D7W7|A0A061D7W7_BABBI) DnaJ domain containing protein, putative {ECO:0000313|EMBL:CDR96776.1} KW=Complete proteome; Reference proteome OX=5866 OS=Babesia bigemina. GN=BBBOND_0306800 OC=Babesiidae; Babesia.
Sequence
MESGVRKTRIPCRGRVLFIAIWCLARVSLVGAKDYYRLLGVSRNATDAEIAKAYRLKAKQ
LHPDVAPGKEEEFKDINTAYEVLKDAEKRQLYDTYGEAGLNGGGAQTQGHQGYDFFRQGG
HGHHGKHSGFTFDMNGGFFEDIFENFAFGGGRQHYGGSHGHHGGRGAGGGGGQRMFKGTL
VEDVDAAGFKASMSTIRTLNLYVFYMDDCPHCRDAKQPISDFATKFQGAIRVYAVNCNRH
NDVCVRNRVEKVPQIVAFAEPNKPVFYDKRTYAEQLDAFVSQALPAEFTIITNRMDLDEF
VFQESKLLKVVAIIKRGVYLTKLKALAKDLRDKVTFAFIRGSNKEMVQVFGTRGATTTGV
LIPVEDPETLTGKTIDMGALGYHDVVLRLNLAQFEAKRSQGVHGNDTNYSQLTARKMANG
ECTASDNQFCFVFVKYGKSSEDEIHEALRGLARKYGNDPIKVRFVNAQEEARFVEAFGMS
PSCPFYQNCAKLVAYRGKRRKYEILDGGLTVENVEQFINNVISGALTLKQTLTHVPTVND
PNQHDEL
Download sequence
Identical sequences A0A061D7W7
XP_012768962.1.43821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]