SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061GHW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061GHW2
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.09e-40
Family PAPS reductase-like 0.0025
Further Details:      
 
Domain Number 2 Region: 253-361
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.53e-22
Family PDI-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061GHW2
Sequence length 364
Comment (tr|A0A061GHW2|A0A061GHW2_THECC) APS reductase 3 isoform 2 {ECO:0000313|EMBL:EOY28727.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_030244 OC=Theobroma.
Sequence
MDRALEKFGDDIAIAFSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYRFFDEVEKHY
GIRIEYMFPDSVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRAWITGQRKD
QSPGTRSEVAVVQVDPVFEGLEGGVGSLVKWNPVANVDGKDIWNFLRAMNVPVNSLHSQG
FVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNLKQDSAAQLNGNGNGAAHSN
GTATQSDIFNSQSLVTLSRTGIENLARLENRKEPWLVVLYAPWCPFCQAMEESYVELAEK
LAGSGVKVAKFRADGEQKEYAQTELQLGSFPTILFFPKHSSRPIKYASEKRDVDSLMAFI
NALR
Download sequence
Identical sequences A0A061GHW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]