SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A066S0M7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A066S0M7
Domain Number 1 Region: 16-160
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000994
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A066S0M7
Sequence length 162
Comment (tr|A0A066S0M7|A0A066S0M7_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KDM93163.1} KW=Complete proteome; Reference proteome OX=1654360 OS=Photobacterium galatheae. GN=EA58_02945 OC=Vibrionaceae; Photobacterium.
Sequence
MSTIDFVSGTSCEQLTSEDWENIEEYLDERFEGKRLPNALNEILNKNNGGMPVQRCFETH
NNKHPIKIFYDLSEDGTIILHESTNMFDMYLFYKERFNNLHLMPIAETSFGDVVVLDYEG
TPKDNPRVALWFHECDEHGMNSQPLEHIADDMASFLDMLTED
Download sequence
Identical sequences A0A066S0M7
WP_036748686.1.33314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]