SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067C3N4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067C3N4
Domain Number 1 Region: 157-350
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.22e-34
Family Ankyrin repeat 0.0007
Further Details:      
 
Domain Number 2 Region: 378-475
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000525
Family Ankyrin repeat 0.005
Further Details:      
 
Domain Number 3 Region: 920-1041
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000488
Family Regulator of G-protein signaling, RGS 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067C3N4
Sequence length 1076
Comment (tr|A0A067C3N4|A0A067C3N4_SAPPC) Uncharacterized protein {ECO:0000313|EMBL:KDO23715.1} KW=Complete proteome; Reference proteome OX=695850 OS=Saprolegnia parasitica (strain CBS 223.65). GN=SPRG_10493 OC=Saprolegnia.
Sequence
MDEVDEDEVRRQVAVALYRHEKGRALALKKQRDIRRAAALQTAKLRRREAACCSEMAAED
TASRAAQAYYFGLLRAEAEKRKYDEEQKVLQLVSAARKTAKSAGAVLSTPGARGLERLEV
LRQRTATIERDAELRRTMRPPGLHLEALRVRTLLAAHGTDHAIECLERAIHEQHWPEMLH
LLATTPRLSADFETSTGYTPLVMALCHCKPSIARTLLSKHGASPHRETSDGKTPLLAAIW
GNDVDGLRLLVQDFGANVRAESTHYVTPLLFAIEKGRLACVQQLLAFGADPNDANVEGTT
PLIAATLAQQMDAIEVLVAAGARWEIRGKDDRTALEWAIRCQFHAFHDRLELLRFRPPTQ
STDRDAARRLRERRADTAIASRDVESLLGMVRRGEVSPNFEGQAHCTPMLAVSRMGTLAQ
LQSLLALGGLPNQPNQLGQTPLLSACERGHGDMLICLVNVGATFAYCDFRGHDAFTHLKE
FPDLVSQWTPYRRQFTTALTLGTPSRLATSSVPHPFGMRTELRPESADILRVATPQLQSP
PEDPDVLDANTQHKWQLQQTGLRQRPGKRRVFEEERHKVLKARQAPRRNALAVVQPDPET
VARPLCGNCVLVRATAYCQECRLAYCDKCVMERHIDADARHHSTGPITPEDICRVKPPKP
SDPPEAQPLSKSVNQSLDAIAALRTLLSASCEPSRAMTPDMDPEIKLRLLRDRREDERRR
REAHLTLNVPQVAASTAAAQGSSLFSKPSEIRLARTYTQQGKFTKAEAVLLDAYNMQVAS
FGATHPLVGKTLYEMGVVSSAKGETRESSAKLLESIACFEQHLPLDHNDLLQSTKALFEC
WSNGREWGLCAAFAKGLSIQRRDALGPEHPLTLEAIALRASYDAQWELQLMLREDARGQR
LLDIATNGASYVDAAQGRRHSQFFKLLTSPKTEDVQRFVRYADTTLYAVYIEFWLAVHGF
HVACDAKAPGFQPYIAARDLFKAFLKTQRIKCTTATLRNEIRQCLRGETKETKPIRDIFN
CVFDLVFQTTWKSVYLPYLQTPDGMAWHEAEHKAAIDEYNDLVASGLLEPRTSPLG
Download sequence
Identical sequences A0A067C3N4
XP_012205533.1.39859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]