SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067DX14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A067DX14
Domain Number - Region: 495-512,616-649
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000115
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067DX14
Sequence length 764
Comment (tr|A0A067DX14|A0A067DX14_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO43136.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g004279mg OC=Citrus.
Sequence
MYRPLLRTRFQLIADSFCKSKFHKHERRNVANKLELSRTLTTTMGLNEESISKATQMQIV
DALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGL
NNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLC
LDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRL
RDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVI
HACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLK
PQDSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAK
MRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISM
KNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGI
PPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALN
LLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYV
NCGFHNSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENL
AFTAALLQLRWCTIVGFPISWSLDRASGLEDSQTNSNSRKQEIA
Download sequence
Identical sequences A0A067DX14
orange1.1g004269m|PACid:18103982 orange1.1g004273m|PACid:18103981 orange1.1g004279m|PACid:18103980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]