SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067FH38 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067FH38
Domain Number 1 Region: 53-244
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.8e-44
Family PAPS reductase-like 0.0031
Further Details:      
 
Domain Number 2 Region: 330-427
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.13e-19
Family PDI-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067FH38
Sequence length 430
Comment (tr|A0A067FH38|A0A067FH38_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO62757.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g042284mg OC=Citrus.
Sequence
MALSSSSSAAAALLNGSGSISSSFAVCYYGPHHKGVEGRIESTNDHEDYEKLARGMESAS
PLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTV
EKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITG
QRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSL
HSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQEELSQHININGNG
VAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSY
IELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVD
SLMAFVNALR
Download sequence
Identical sequences A0A067FH38
orange1.1g042284m|PACid:18108637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]