SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067GM85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067GM85
Domain Number 1 Region: 55-171
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000179
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  A0A067GM85
Domain Number - Region: 19-53
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0288
Family Mitotic arrest deficient-like 1, Mad1 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067GM85
Sequence length 202
Comment (tr|A0A067GM85|A0A067GM85_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO76547.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g024795mg OC=Citrus.
Sequence
MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA
RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS
DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPS
TPNGSSENNCQICTWVKKTEIR
Download sequence
Identical sequences A0A067GM85
orange1.1g028850m|PACid:18118499 orange1.1g028877m|PACid:18118495 orange1.1g028879m|PACid:18118498 orange1.1g028886m|PACid:18118494 orange1.1g028905m|PACid:18118496 orange1.1g028919m|PACid:18118493 orange1.1g028920m|PACid:18118497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]