SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067GRR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067GRR0
Domain Number 1 Region: 66-278
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.84e-26
Family BAR domain 0.044
Further Details:      
 
Domain Number 2 Region: 285-364
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000158
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A067GRR0
Sequence length 371
Comment (tr|A0A067GRR0|A0A067GRR0_CITSI) Uncharacterized protein {ECO:0000313|EMBL:KDO78016.1} KW=Complete proteome; Reference proteome OX=2711 OS=Citrus sinensis (Sweet orange) (Citrus aurantium var. sinensis). GN=CISIN_1g017467mg OC=Citrus.
Sequence
MESLRRQASKLKEQVAKQQQLCIAIKIDDILNEFNTFSFQAVIKQFSASGYERSDVMVID
EVEMQRHQQLEKLYRSTRGTKDFQRDLVKVAEVFTAIGYKHIEAGTKLSEDCCRYGAENN
QNINENILPKAAAIYGDARKHVEKEQEDFNRLLSSQVLDPLRAMITGAPLEDARHLAQRY
SRMRQEAETQAVEVSKRQQRVREAPNPENVAKLHAAEARMQELKANMAILGKEAAAALAA
IEAQQHRLTFQRLVAMVEGEKNYHLRIAAILGDVEAEMVSEKQRKESAPPVIPSENSSQK
AVYFLAEAIHPFTAASEKELSLGVGDYVVVRKVSPSGWSEGECKGKAGWFPSANVEKRQR
IPVSNVADEAY
Download sequence
Identical sequences A0A067GRR0
orange1.1g017467m|PACid:18112148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]