SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067JTJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067JTJ5
Domain Number 1 Region: 16-94
Classification Level Classification E-value
Superfamily Chaperone J-domain 6.02e-28
Family Chaperone J-domain 0.00023
Further Details:      
 
Domain Number 2 Region: 200-308
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000651
Family Thioltransferase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A067JTJ5
Sequence length 575
Comment (tr|A0A067JTJ5|A0A067JTJ5_JATCU) Uncharacterized protein {ECO:0000313|EMBL:KDP22864.1} KW=Complete proteome; Reference proteome OX=180498 OS=Jatropha curcas (Barbados nut). GN=JCGZ_00451 OC=Crotonoideae; Jatropheae; Jatropha.
Sequence
MNRHFTLSITVVLFLVLLTGDAKTIDPYKVLGVERNASQREIQKAFHKLSLQYHPDKNKN
KGAQEKFAEINNAYEILSDEEKRKNYDLYGDEKGNPGFDAGHPGDQGGYTYFTTGGQGQN
RFKFRPDEWSNMGGQGGSQSFSFSFGGPSAQNSFGFGLNDIFSNFFGGDTGGGPFGSFSG
SARSQSSFQSGSRSSPKNMKPVNSKVFKKEIADQGMTWLLLSYTPSLRGSNYHESVMQEV
ADSLQGALKVGSINCEAEKSFCTELGIHPRRVPRVFLYSYKAGDKGSLVEYTDDLVARNL
KTFCQDHLPRFSRRIDVKYFQSSSGSREQLPKVLLLSTKKDTPVIWRVLSGLYHKRFIFN
DAEVHGVTDPIVKTVGVDALPAIVGWLSNGEKYVLKAGISVKDLQSAIHDLSSLLEDFDK
QNKKAAPNQAREQDDPVEKQLPLLTGLNFDALCGEKIPVCIIGAFRSSKAREKIKSILST
VSQKSFTRQRNAASGSRDSISYALLDANRQPAFLNAFEKSGFKSSDKLLLAYKPRKGKFA
ALAGDISVEQVERFISSVLNGDVQFTKLRQKPLVK
Download sequence
Identical sequences A0A067JTJ5
XP_012089815.1.15751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]