SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A067T7D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A067T7D1
Domain Number 1 Region: 400-476
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000439
Family UBX domain 0.048
Further Details:      
 
Domain Number 2 Region: 193-280
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000403
Family Thioltransferase 0.029
Further Details:      
 
Weak hits

Sequence:  A0A067T7D1
Domain Number - Region: 5-46
Classification Level Classification E-value
Superfamily UBA-like 0.00536
Family TAP-C domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A067T7D1
Sequence length 572
Comment (tr|A0A067T7D1|A0A067T7D1_GALM3) Uncharacterized protein {ECO:0000313|EMBL:KDR79095.1} KW=Complete proteome; Reference proteome OX=685588 OS=Galerina marginata (strain CBS 339.88). GN=GALMADRAFT_242958 OC=Galerina.
Sequence
MDSLDDEQRRALGQLREITNGADDEVAVSVLDSVGWDVQRAAELIFGTSAIPPPSTSIET
FDIDDSQQGEPVRQRHTPSSSALTRPLFSFLAFPFHVISSLFRFIFGILRIPIPQFRFMG
LNFYRPLRPRPTSRGGPDRWLRDLEEETGAISIGRSKAPRGTTSSLNIDAGQSSLTSRLP
SANGQTEDGRKYLPDFTISTYEDMLRMCQREAKIGCVILVSDEHDDVPEFKRSTLTDPIF
VKTLFDNDIIVWGGDVRDRDPWSAAEKLQATTYPFVAFLALQPRRGPMSSSSSSSTSPPS
LTVLSRHQGKSIPASSPTSAQSLVDHLEQQLLPRVKPFLDSITAEQRERERDRHIREEQD
RAFQNTARRDKERIEGKIAAERAEREARRMAEAEAHLAEQRRAREAELARQRENDRMDWR
RWTRRAIVNAQPMRSVTSSLRIAIRLPNGARVVHSFPQSASLTTLYAFVDSQFIPPQILA
SDDPVSLPGLKGVGESALESHISTHQDQYWGFRVASAYPRVEIPWKPAAKLSDVDQLKGG
GQVVVELVQGGRSAAIQQDGEDDDGYHTEDSE
Download sequence
Identical sequences A0A067T7D1
jgi|Galma1|242958|fgenesh1_kg.7_#_2_#_Locus796v1rpkm155.38

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]