SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LH68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LH68
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily gp120 core 4.58e-56
Family gp120 core 0.00000629
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068LH68
Sequence length 114
Comment (tr|A0A068LH68|A0A068LH68_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46568.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENITNSVKTIIVHLNDSIDIVCTRPG
NNTIKSMRIGPGQAFYATGQIVGDIRQAHCNISKVVWENTLFRVGEKLQKYFNN
Download sequence
Identical sequences A0A068LH62 A0A068LH68 A0A068LH74 A0A068LH80 A0A068LHG1 A0A068LHH2 A0A068LHH7 A0A068LHW3 A0A068LHX1 A0A068LHX6 A0A068LHY2 A0A068LJJ6 A0A068LJK1 A0A068LJK7 A0A068LJL2 A0A068LN93 A0A068LN99 A0A068LNA4 A0A068LNB0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]