SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LJH4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LJH4
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily gp120 core 1.2e-57
Family gp120 core 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A068LJH4
Sequence length 113
Comment (tr|A0A068LJH4|A0A068LJH4_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46545.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENLTNNAKTIIVHLNESVEIECTRPG
NNTRKSVRIGPGQVFYTNDIIGDIRQAHCIINATKWNRTLQQVGKKLAEHFPN
Download sequence
Identical sequences A0A068LH40 A0A068LH44 A0A068LH51 A0A068LH56 A0A068LHD8 A0A068LHE5 A0A068LHF0 A0A068LHF5 A0A068LHV3 A0A068LJH4 A0A068LJH9 A0A068LJI5 A0A068LN71 A0A068LN76 A0A068LN83 A0A068LN88

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]