SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LJN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LJN9
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily gp120 core 3.92e-59
Family gp120 core 0.00000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068LJN9
Sequence length 114
Comment (tr|A0A068LJN9|A0A068LJN9_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46610.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIKPVVSTQLLLNGSLAEEEIIIRSENMTDNVKTIIVHFKEPVEIVCTRPN
NNTRKSMRIGPGQTFYATGDIIGNIRQAHCNINAENWTNTLEEVSKKLREHFPN
Download sequence
Identical sequences A0A068LHB3 A0A068LHC0 A0A068LHC8 A0A068LHD4 A0A068LHK4 A0A068LHL0 A0A068LHL6 A0A068LI21 A0A068LI30 A0A068LI36 A0A068LI45 A0A068LJN5 A0A068LJN9 A0A068LJQ1 A0A068LND7 A0A068LNE2 A0A068LNE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]