SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A068LNM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A068LNM3
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily gp120 core 7.19e-60
Family gp120 core 0.00000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A068LNM3
Sequence length 114
Comment (tr|A0A068LNM3|A0A068LNM3_9HIV1) Envelope protein {ECO:0000313|EMBL:AIE46659.1} OX=11676 OS=Human immunodeficiency virus 1. GN= OC=Lentivirus; Primate lentivirus group. OH=9606
Sequence
NVSTVQCTHGIKPVVSTQLLLNGSLAEGEIIIRSENLTNNVKTIIVHLNESVDIVCTRPN
NNTRKSVRIGPGQTFYATGDIIGNIRQAHCNISESKWNKTLQRVKEKLGKHFPN
Download sequence
Identical sequences A0A068LHK5 A0A068LHL4 A0A068LHV1 A0A068LHV4 A0A068LHV7 A0A068LHW1 A0A068LIC6 A0A068LID4 A0A068LJX1 A0A068LJX2 A0A068LJX9 A0A068LNM3 A0A068LNM8 A0A068LNN2 A0A068LNN6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]